KEGG   Stanieria cyanosphaera: Sta7437_1894Help
Entry
Sta7437_1894      CDS       T02406                                 

Definition
Endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
scs  Stanieria cyanosphaera
Brite
Enzymes [BR:scs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Sta7437_1894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2127698..2128786
Genome map
AA seq 362 aa AA seqDB search
MITRRIFLNYSTIAAISYSLTINSCSKVSNPPNNTLSNIAKMNQRLYGSAINSSYMNDVT
YLQLIKDNCNIITPEWEMKWAELEPTPGEFNTYNLDKIIDFAVTNNLKVRGHTLFWDTSH
PKHRSFPPSVQEFSDMYEQVMRRYEQKNVIFCWDVINEVLIDPQMNPSDTTDNPDWSLLK
GVTPELLRDIVQVVNRRSPNLETYINDFNIEQAGDKQDKFLKLGQYLAQNTNLTGLGIQS
HLIFSKENPFQIDEFEDLLKKIKDIGLKPVITELDVIMYPPFPNSIEEIDHIIGDLYQKY
CETAINNGVDTIVTWGITDKFSYIYDFTQQQREQTRPHPFDSHMNPKKARDAIAEALSMP
IK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgattacccgacgtatttttctaaattattccacaattgctgctatatcatacagtttg
acaattaatagttgttctaaagtttctaaccctcccaataatactcttagtaatattgca
aaaatgaatcagcgtctttatggttcagcgatcaatagcagctatatgaatgatgtaacg
tatttgcaactaataaaagacaactgcaacattatcactccagaatgggaaatgaaatgg
gcagaattagaaccaactcctggtgagtttaatacatataatcttgataaaattatcgat
tttgctgttaccaataaccttaaagtgcgcggacacactcttttttgggatacttctcat
cctaaacaccgcagttttcctcccagcgtacaagaatttagcgatatgtacgagcaagtg
atgagaagatacgaacaaaaaaacgttatcttttgctgggatgtgattaacgaagttcta
atcgatccacaaatgaatcctagcgatactacagataatccagattggagtttattgaaa
ggtgtcacaccagaattacttagggatattgtccaggttgttaatcgcagatcgccgaat
ttggaaacttatattaatgattttaatattgaacaagcaggtgacaaacaagataaattt
ttaaaattaggtcaatatttggcacaaaataccaacttaacagggttaggtatacaatct
catctcattttttctaaagagaatccctttcagattgacgaatttgaagatttattaaaa
aaaatcaaagatattggactaaaaccagtcattactgaacttgacgtgattatgtatcca
ccatttccgaattctattgaggaaattgaccatataataggtgatttgtatcaaaaatac
tgtgaaactgctatcaataatggtgtagatacaattgttacctggggaataacagataaa
ttttcctacatatatgattttacacaacagcaacgagaacaaacgcgcccacacccattt
gatagtcatatgaatcccaaaaaagctcgagatgcaatagcagaagctttatcaatgcca
atcaaatga

DBGET integrated database retrieval system