KEGG   Stanieria cyanosphaera: Sta7437_1949Help
Entry
Sta7437_1949      CDS       T02406                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
scs  Stanieria cyanosphaera
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:scs00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sta7437_1949
Enzymes [BR:scs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Sta7437_1949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2189170..2190102
Genome map
AA seq 310 aa AA seqDB search
MTVVVFGSINIDLVVEVPRLPSRGETVIGHRFFTAGGGKAANQAVAVAKLGVPTHLIGQI
GDDEFGQILLKNLHNLGISTEGVVINPHTHSGVASIVVEERGDNIIACAAGANNLVGEAE
LRQFQTLLPQAKVALLELGIPLSTVIAAAQTAKNSNCWVILDPAPAQPNLPNELYSLVDL
ITPNEIEASQLVGFTVDGVTTARQAATFLHQMGAKNVVITLGNQGAFCSTGDENYWVKPV
SVRVVDTVAAGDAFNGALAAALASGKSLKEAVQWGNIAGALAVTKPGAQPSLPSRDIFMK
MLAEQSPYFD
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgacagttgttgtctttggcagtattaatattgatctagttgtagaagttcctcgacta
ccaagcaggggagaaacagtgattgggcatcgttttttcaccgccggaggaggaaaggca
gctaatcaagcagtggcagtagccaaattaggtgttccgactcatttaatcggtcaaatc
ggtgatgatgaattcggtcaaattttgctaaaaaacctccataatctgggaataagcacc
gaaggagttgtaattaacccccatactcactcgggtgtagcttcaattgtagtagaagaa
agaggagataatatcattgcctgtgctgctggggcaaataatttagtcggagaagcagaa
ttgcgacaatttcagactttactaccccaagcaaaagtagctttattagaattgggcatt
cctctctctactgtcatagcagcagcccaaactgctaaaaatagtaactgttgggtaatt
ttagatcctgcaccagcccaacctaatctacctaacgaattgtattctctggtagattta
ataactcccaatgaaatagaggctagtcagttagtaggttttactgttgatggcgtaact
acggctagacaagcagctacttttttacatcaaatgggagctaaaaatgtagtaattacc
cttggtaaccaaggagctttttgcagtacaggagacgaaaattattgggtgaaaccagtc
tctgtaagagtagtcgatactgtcgctgctggagatgcttttaatggggcattggctgct
gcgttagcttcaggcaaatcattaaaagaagccgtacagtggggtaatattgcaggtgct
ttagcagttactaaaccaggagcgcagccttctcttcctagtcgagatatttttatgaaa
atgcttgctgaacaatctccctattttgattaa

DBGET integrated database retrieval system