KEGG   Stanieria cyanosphaera: Sta7437_2017Help
Entry
Sta7437_2017      CDS       T02406                                 

Definition
Sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
scs  Stanieria cyanosphaera
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:scs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sta7437_2017
Enzymes [BR:scs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Sta7437_2017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2267223..2268974
Genome map
AA seq 583 aa AA seqDB search
MTVSIEQVKHFSWKVKPLLQRLYGKEAAEKLVDKIYLLLAEHFAPLKEENLNKWSQNNVL
LITYGDSVINPTTAEKPLTTLDRFLTKYFHETVTGIHILPFFPYSSDDGFAVIDYLQVNP
KLGDWEDIENIASKFNLMVDLVINHVSSQSVWFKQYQQGEKPGCDYFIEVEPSIDLSEVV
RPRSSSLLAPVKTVNGTKYLWATFSHDQLDLNFANPDVLIEFIKIILFYVQRGAKYIRLD
AVGYLWKKIGTSCIHLTETHAAIRLMRELLQMLNADVALITETNVPNRENLSYFGNRDEA
HMIYNFSLPPLLLNALLQGKSEHLKTWMMSMPPAPIGCAYLNFTASHDGIGVRPAEGLLA
EEEYHQLLETMQKFGGQISMRQKADGTESPYEINISLFDALRGTVRGEDQWQVERFICSQ
TIMMSIEGIPAFYIHSLLATPNDYDNVAKTGRKRSINRHQWEINQLEELLSDPQSPQSRV
LKELSRRIKIRRRQPAFHPNATQYTLHPMNKTLFAFWRQSRERDQSIFCIFNLSDRQQKL
RLSYLNLVCTDTWYDLIGNKILDEQDDKMMLKPYQSIWLTNKF
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgacggtatcgatagaacaagtcaaacatttttcctggaaagtaaaaccattactccaa
agactgtatggtaaagaggcagcagaaaaactggtagacaaaatttatcttctactggca
gaacatttcgcaccgttaaaagaagaaaatttaaataaatggagtcaaaataacgttctt
ctcattacttacggtgatagtgtaattaatcctactacagcagaaaagcctttaactact
ctcgatcgctttctcactaaatattttcatgagacagttacgggaattcatattttacct
ttttttccctatagttctgatgacggttttgctgtaattgattatctgcaagtcaatccc
aaattgggagattgggaagatattgaaaacattgccagtaaattcaatttaatggttgat
ttggtaatcaatcatgtttccagtcaaagtgtttggtttaaacaatatcagcaaggagag
aaacctggatgtgattattttattgaagtagaaccaagtatagatcttagcgaagtagtt
cgtccccgcagcagttcacttttagccccagttaaaacagttaatggaacaaagtatctc
tgggcgacttttagtcacgatcaactcgatctcaattttgctaaccctgatgttttgatc
gaatttattaaaattatcctcttttatgttcaaagaggcgcaaaatatattcgtctcgat
gcggttggttatctctggaaaaaaattggcactagctgtattcatctaactgaaacccat
gcagcaattagactgatgcgcgaattgttacaaatgttaaatgctgatgttgctttaatt
accgaaacaaatgtacctaatcgagaaaatttaagctactttggtaatcgagacgaagcg
cacatgatctacaactttagtctcccgcccttactcctcaatgcacttttgcaaggaaaa
tcagaacacctcaaaacctggatgatgagtatgccaccagccccaattggttgtgcttat
cttaactttactgcttcccatgatggtattggtgttcgtcccgccgaaggattactagca
gaagaagaatatcatcaactgttagaaacaatgcaaaaatttggcggacaaatcagtatg
aggcaaaaagctgatggtacagaaagtccttatgaaatcaatatttctttgtttgatgcc
ttaagaggaactgttcgcggagaagatcaatggcaagtggaaagatttatctgttcccaa
accattatgatgtcgattgaaggcattcctgccttttacattcatagtttattggcaact
ccgaatgattatgataatgttgctaaaactggacgcaaacgttcgattaatcgtcatcaa
tgggaaattaatcaattagaagaattgttaagtgatcctcaatcacctcaatctcgtgtt
ttgaaagaacttagtcgcagaattaaaattcgccgtcgtcaacccgcttttcatcctaat
gcgactcaatacactttgcacccgatgaataagactttatttgctttttggcgccaaagt
agagaaagagatcaaagtattttctgtatttttaatcttagcgatcgccagcagaaatta
cgtctatcttatctcaatttggtttgtactgatacttggtacgatttgattggtaataaa
atactcgatgagcaagacgataaaatgatgctcaaaccttatcaatcaatttggttgacc
aataagttttaa

DBGET integrated database retrieval system