KEGG   Stanieria cyanosphaera: Sta7437_2337Help
Entry
Sta7437_2337      CDS       T02406                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
scs  Stanieria cyanosphaera
Pathway
scs00010  Glycolysis / Gluconeogenesis
scs00520  Amino sugar and nucleotide sugar metabolism
scs01100  Metabolic pathways
scs01110  Biosynthesis of secondary metabolites
scs01120  Microbial metabolism in diverse environments
scs01130  Biosynthesis of antibiotics
scs01200  Carbon metabolism
Module
scs_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:scs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sta7437_2337
   00520 Amino sugar and nucleotide sugar metabolism
    Sta7437_2337
Enzymes [BR:scs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Sta7437_2337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: AFZ35878
UniProt: K9XTL2
Position
2645761..2646474
Genome map
AA seq 237 aa AA seqDB search
MNSNQTEQGIRTLGVDIGGSGVKAIVLDEQGLTITERSRVKTPQPATPEAVLNAIASLAS
EQGEFERVAVGFPGVVQYGITKTAVNLDPQWENFNLGDALSKLLAKPVKVANDADIQGLG
AIKGQGVELVLTLGTGFGSALFIDGKLVPNLEMGHHPFRKGETYEEQLGRAALNKIGVQK
WNNRLQRAIANLEHLFNYNTLYLGGGEAKNINFQLPESVVVIPNISGLLGGIKLWQN
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcaatcaaacagagcaaggtatccgcactttgggagtagatattggcggtagt
ggcgttaaagctatagttttagatgagcaaggattgactataactgaacgcagtcgagtt
aaaactcctcaaccagctactcctgaagcagttcttaatgctattgctagtttagcctca
gaacaaggagaatttgagcgagttgcagtaggatttcctggggttgtgcagtatggaatt
acaaaaactgcggtaaatctcgatccgcaatgggaaaattttaatctaggtgatgcttta
tcaaaacttttagctaaacctgtcaaagttgctaatgatgcagatattcaaggtttaggc
gcaattaaaggacaaggagtagaattagttctaaccttgggaactggatttggttcggca
ttatttattgatggtaaattagttcctaatttggaaatgggacatcatccttttcgcaag
ggagaaacctatgaagaacaactgggtagagcagctttaaataaaataggtgtacaaaaa
tggaataatcgtcttcaaagagcgatcgcgaatcttgaacatctatttaattacaataca
ctttatctcggtggtggtgaagctaaaaatattaattttcaattacctgaaagtgtggta
gttattcctaatatttcagggttattgggtgggattaagttgtggcaaaattaa

DBGET integrated database retrieval system