KEGG   Stanieria cyanosphaera: Sta7437_2471Help
Entry
Sta7437_2471      CDS       T02406                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
scs  Stanieria cyanosphaera
Pathway
scs00860  Porphyrin and chlorophyll metabolism
scs01100  Metabolic pathways
scs01110  Biosynthesis of secondary metabolites
scs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:scs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sta7437_2471
Enzymes [BR:scs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Sta7437_2471
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Sta7437_2471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase Amidinotransf
Motif
Other DBs
NCBI-ProteinID: AFZ36005
UniProt: K9XTS5
Position
complement(2785973..2787502)
Genome map
AA seq 509 aa AA seqDB search
MQNLGKVYLVGAGVGELAYLTLRGKQLLTEAEVLIYDALVDSDLLTLVSPNCLKLDVGKR
GGQPSTPQAQINQLLVAYCLQGKQVVRLKSGDPFIFGRVREEIEALVAAECAFEVVPGIS
SVLAAPTFAGIPLTDKYLSNCFAVLSGHQPELLDWNALAKIDTLVILMGTRYLAEIVTKL
LACGRIADEPVAIICNCSRPEQKIFQGTLTDIVDRTRGISLSPAVIVIGKVVDLASQLQS
SPSSAVLTGKTILVTRAAEQSSQFRDLLQQHGAKVLEMPALEIMPPSSWQTLDNAIANLP
QFNWLILTSANGVEYFFERLATLGKDARSLAGIKIAVVGKKTAATLQRKKLQPDFIPPDF
VADSLVAHFPEVLEGQKILFPRVETGGREILVKELTTQGAEVTEVPAYQSGCPQKITAEI
WQALQQKQIDAITFASSKTVRNFHQLVQQELGHSDILLTTLLENICLASIGPQTSQTCQE
LFNRVDVEAQEYTLEGLTTALVNYFSNIK
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacctagggaaagtatatttagtaggtgctggcgttggtgaacttgcgtacctt
actttaagagggaaacagttactcactgaagctgaagtcttaatttatgatgccctagtc
gattcagacttattaactttagtctcaccaaactgtctcaagttagatgtagggaaaaga
ggagggcaaccaagtaccccccaagcacaaatcaatcaattattagttgcttattgttta
caaggcaaacaagtagttagattaaaaagtggcgatccgtttatttttggtcgagttaga
gaagaaattgaagcattagttgctgccgaatgtgcatttgaagttgtgccagggatttct
tcagttttagctgcccctaccttcgctggtattcccttaactgataaatatttaagtaat
tgttttgcagtcttaagcggacatcaaccagaattactcgattggaatgctttagctaaa
atcgatactttggtaatactgatgggaacacgttatttagcagaaatcgttactaaatta
ttagcttgtggcagaattgctgatgaaccagtagcaattatttgtaactgtagtcgtccc
gaacaaaaaatttttcaaggtactttaaccgatatagtagatcgaacaagggggatttct
ctttctccagcagtaatagttataggtaaagttgtggatttagctagtcagttacaatct
tccccatcttcagccgttttaacaggaaaaaccattttagttacccgcgcagccgaacaa
tctagtcaatttcgcgatttattgcaacaacatggggcaaaagttttagaaatgcctgcc
ttagaaattatgcctccctctagttggcaaactttagataatgcgatcgcaaatttgcct
caatttaattggttgattttaacttctgctaatggcgtagagtatttctttgaacgttta
gctactttgggtaaggatgctcgtagtttagcaggaattaaaatagcagtggttggtaaa
aaaactgctgccactttacaacgaaaaaaactgcaaccagattttattcccccagatttt
gtagctgattctttggttgctcattttcctgaagttttagaagggcaaaaaattctcttt
cctcgtgttgaaactggtggtagagaaatactagtgaaagaattaactactcaaggtgca
gaagttacagaagtacctgcttatcaatctggttgtccccaaaaaattactgctgaaatt
tggcaagcactacaacaaaaacagatagatgcaattacatttgctagttctaaaacagtc
agaaattttcatcaattagttcaacaagagttgggtcattcggatattttgctaacaact
ttgcttgaaaatatttgtcttgcttcgattgggcctcaaacttctcaaacctgtcaagaa
ttatttaatcgagtagatgtagaggcacaagaatatactttagaaggattaaccactgcc
ttagtaaattacttttcaaatatcaaataa

DBGET integrated database retrieval system