KEGG   Stanieria cyanosphaera: Sta7437_2851Help
Entry
Sta7437_2851      CDS       T02406                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
scs  Stanieria cyanosphaera
Brite
Enzymes [BR:scs01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Sta7437_2851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3247166..3247771
Genome map
AA seq 201 aa AA seqDB search
MIDLYTFTTPNGRKISIMLEELELDYNVHTIDITKGEQFTPEYIAINPNSKIPAIVDRDA
DLTVFESGAILIYLAEKTEKFLPTETKQRFQVLEWLMFQMGSVGPMFGQYNHFNHYAPEK
IPYAIERYQKETLRLYGVLDRQLTDRTFICEDYSIADMATFPWVAGYQFMGLTLDHHPNL
KRWVETMQQRSAVKKGMAVPA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctttacacttttacgactcccaacggtcgcaaaatctctatcatgttagag
gaattggaattagactataacgttcatacaattgacattaccaagggcgaacaattcaca
ccagaatatattgcgattaatcccaatagtaaaatacctgcgatcgttgatcgcgatgct
gatctaactgtctttgaatctggcgcaatcttaatttatttggcagaaaaaaccgaaaaa
tttttaccgaccgaaacaaaacaacgttttcaagttttagaatggctgatgtttcaaatg
ggaagtgttggccctatgtttggtcaatacaatcactttaatcattatgcccctgaaaag
attccttatgctattgaacgttatcaaaaagaaactttaagactatatggtgtattagat
cgacaacttactgacagaacatttatttgtgaagattattcgattgcagacatggctact
tttccttgggtagcaggttatcaatttatgggattaactctagatcatcatcctaattta
aaacgatgggtagagacaatgcaacaacgttcagcagtaaaaaaaggtatggcagtacca
gcttaa

DBGET integrated database retrieval system