KEGG   Stanieria cyanosphaera: Sta7437_2895Help
Entry
Sta7437_2895      CDS       T02406                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
scs  Stanieria cyanosphaera
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sta7437_2895
Enzymes [BR:scs01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Sta7437_2895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3303412..3305430
Genome map
AA seq 672 aa AA seqDB search
MSALTTAPVNINFPLTAIIGQEAIKLALLLAAIDPELGGVAIAGRRGTAKSVMARGIHSL
LPPIEIIKGSLYNCDPSKPREWDDDTIELYGNSNLAEISTEVIPAPFVQIPLGVTEDRLL
GSVDVEESVKQGEAVFQPGLLAQAHRGVLYIDEINLLDDQIANQLLTVLTEGRNQIEREG
ISFQHPCKPILIATYNPEEGNLREHLLDRIAIALSADGVLSLDQRVQAVDQVIDYASSPQ
NFINQYSEDIDTLKTDIILAREWLKEVKISHDQILYLVQEAIRGGVEGHRAELFAVRVAK
AAAALEGRNNVIADDLKKAVELVIVPRATTVEMPPEDAPPPPPPPPQEQPQDESNQDQEE
QEEKEEEEDKEQEPPGIPEEFVFDIEGVILDPSVLYFAQMTKRQGKSGNRSLIFSEDRGR
YIKPMFPKGKVRRIAVDATLRSAAPYQKARRERYPNRKVIVEQGDIRAKRLARKAGSLIV
FVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQVSLIPFRGERADVLLPPTRSITMARG
RLESLPCGGGSPLAHGLTQAVHVGMNAQMSGDIGQVVIVAITDGRGNIPLARSLGEPLVE
GEKPDIKGELLEIAGKIRALGMKLLVIDTESKFVTTGFAKELAKQAGGTYYHLPKATDRA
IADMARGAISNL
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgcttactactgcccctgtaaatattaattttcctctgacagcaattatcgga
caagaagcgattaaattagccttgctgttagcagcaatcgatccagaattaggtggtgtt
gcgatcgcaggaaggcgaggaacggctaaatcagttatggcgagaggcattcatagttta
ttgccaccgattgaaataattaagggttctttatacaattgcgatcccagtaaaccccga
gagtgggatgacgataccatagaactttatggcaatagtaatttagcagagatttctaca
gaagttattcctgccccttttgtacaaattcctttgggtgtaactgaagatcgtttattg
ggttcggtagatgtagaagagtcagttaaacaaggcgaagcagtctttcaaccaggatta
ttagcccaggcacatcgaggagtgttgtatattgatgagattaatctccttgacgatcaa
attgccaaccaactattaaccgttttaactgaagggcgtaatcagatcgaacgagaaggg
atttcctttcaacatccctgtaaaccaattctgattgccacttataaccctgaagaaggt
aatcttagagaacatttattagaccgaattgcgatcgctctttctgccgatggagtttta
tctttagatcaacgagtgcaagcagtcgatcaagttattgattatgctagttctcctcaa
aatttcattaatcaatatagtgaagatattgatactctcaaaaccgatattatcttagct
agggaatggctgaaagaagtcaaaattagtcacgatcaaattctttatttggtacaagaa
gcaattagaggaggagtcgaagggcatcgggcagaattatttgccgtcagggtagctaaa
gctgctgctgcattggaaggaagaaataatgttattgctgatgatttgaaaaaagcggtg
gaattagtaattgttccccgcgctaccacagtggaaatgcctcccgaagatgcaccacca
cccccaccaccaccgcctcaagaacaaccccaagacgaatctaatcaagatcaagaggaa
caagaagaaaaagaagaggaagaagacaaagaacaagaaccaccaggcattcctgaagag
tttgtctttgatatcgaaggtgtaattttagaccccagcgtactttactttgcccaaatg
actaaacggcaaggaaaatcgggtaatcgcagtctgattttttcagaggataggggtaga
tatattaaacccatgtttcccaaagggaaggtaagaagaattgcggttgatgctactctt
cgtagtgctgcaccctatcaaaaagcgagaagggaacgttatccaaatcgcaaggtaatt
gttgaacaaggtgatattagggcaaaacgattagctaggaaagctggttctttaattgtt
tttgttgtagatgcttctggttcgatggcattgaatcgaatgcagtcagctaaaggtgcg
gtgatgcgcttgttaactgaagcttatgaaaatcgcgaccaagtttccctgattcccttc
cgtggtgaacgggcagatgtgctgttacctcccactcgttcgattactatggcgcgtgga
cgtttagaaagtcttccttgtggtggaggttctcccctagcacacggtttaacccaagcg
gttcatgttggcatgaatgcgcaaatgtcgggagatattgggcaggtagttattgttgcc
attaccgatggtagaggaaatatacctttagcccgttctttaggagaacctttagtagaa
ggagaaaaaccagatattaaaggggaattactagaaattgctggaaaaatacgcgcttta
ggcatgaaattgctggtaattgataccgaaagtaaatttgtgactactggttttgctaaa
gaactcgccaaacaagctggtggaacatactatcatttacccaaagcaactgatagagcg
atcgcagatatggcaagaggtgcaatttccaacctttaa

DBGET integrated database retrieval system