KEGG   Stanieria cyanosphaera: Sta7437_3027Help
Entry
Sta7437_3027      CDS       T02406                                 

Definition
Stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
scs  Stanieria cyanosphaera
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:scs00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Sta7437_3027
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Sta7437_3027
Enzymes [BR:scs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Sta7437_3027
Lipid biosynthesis proteins [BR:scs01004]
 Desaturase
  First
   Sta7437_3027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3436544..3437377
Genome map
AA seq 277 aa AA seqDB search
MTVATSDRLPPDWLNISYFGLIHLVALLAVFPQNFSWGAVGVAFLLYWLTAGIGITLGFH
RLVTHRSFETPKWVEYILVFCGTLACEGGPLDWVGAHRIHHKHSDTELDPHDSNRGFWWS
HIGWMMCEHPVNQEIPRYTKDIADDPFYQFCQKYLVPIQVGLGLLLYFIGGWSYVIWGIF
VRLVVVFHVTWLVNSATHKFGYKSHESNDNSTNCWWVALLTFGEGWHNNHHAYQYSARHG
LRWWEIDATWMTIKLLEFLGLAKNIKLPPTQTKQTQV
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgacagttgctacatcagatcgacttcctccagattggctcaacattagctattttggg
ctaatacatttagtcgccttattagctgttttcccccaaaatttcagttggggagcagtc
ggagttgcttttcttctttattggttaacggcagggatcgggattactcttggatttcat
cggctagttacccatcgcagttttgaaactcctaaatgggtagaatatatcttagttttt
tgtggaactctagcttgtgaaggaggtccccttgattgggttggagcgcatcgaattcat
cataagcattctgatacagagttagacccccacgattctaatcggggtttttggtggagt
catatcggttggatgatgtgtgaacatcccgtcaatcaggaaattcctcgttataccaaa
gatattgctgatgatcctttttatcaattctgtcaaaaatatttagttcctattcaagtt
ggtttaggcttacttttatattttattggaggttggtcttatgtcatctggggaattttt
gttcgtctggtagttgtgttccacgttacctggttggtcaatagcgcaactcataaattt
ggctataaaagtcatgaatcaaacgataattcaaccaattgttggtgggtagcgttactt
acttttggggaaggttggcacaacaaccaccatgcctaccaatattctgcgcgtcatggt
ttaagatggtgggaaatcgatgctacgtggatgacgattaaattacttgaatttttagga
ttagcaaaaaatattaaattaccaccaactcaaactaaacaaactcaagtttaa

DBGET integrated database retrieval system