KEGG   Stanieria cyanosphaera: Sta7437_3124Help
Entry
Sta7437_3124      CDS       T02406                                 

Definition
Glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
scs  Stanieria cyanosphaera
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:scs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sta7437_3124
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Sta7437_3124
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Sta7437_3124
Enzymes [BR:scs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Sta7437_3124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3544501..3545613
Genome map
AA seq 370 aa AA seqDB search
MSESQTIVIKIGTSSLTKATGQIAVATIASLVETLTSLRSDGHRVVLVSSGAVGVGCARL
NLKERPRKIAVKQAVAAVGQGRLMRIYDDLFSSLQQPIAQVLLTRRELMERTSYVNAFNT
FIALLELGVIPIVNENDTVAIDELKFGDNDTLSALVASLIEADWLFILTDVDRLYSADPR
LNPDAQPIELVGSAEFKQLQVEAGGNGSQWGTGGMATKLAAARIATSSGVRTVITQGKQP
QNILQIIQGEPLGTQFEPQSRADNARKRWINYGLIPMGKLYLDRGAVKAICQQGKSLLPA
GIIKIEGDFVASDAVQLCDGEGREIGRGLVNYSSTEITQIKGHHSEKIAQILGYEGADTV
VHRNNLIIKD
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaatcacaaactatcgtcattaaaatcggtacatctagtttaaccaaagcaaca
ggacaaattgccgtagctactatagcttctttagtagaaacccttacctctttacgttct
gatggtcatcgagttgtattagtttcttctggtgcagtgggagtaggatgtgccagatta
aaccttaaagaaagaccccgtaaaatagcagttaaacaagctgttgctgctgttggtcaa
ggtcgtttgatgcgtatttatgatgatcttttttccagtttacagcaaccgattgctcaa
gttcttctaactcgtcgagaattaatggaaagaacttcttatgtgaatgcttttaatact
tttattgctttattagaattaggagttattccaattgttaatgaaaacgatactgtcgca
atagatgaattaaaatttggcgataacgatactttatctgctttagttgccagtttaatt
gaagctgattggttatttattttaactgatgtagaccgcttatattcagcagatccccgt
ctgaatcctgatgctcaaccgattgaattagtaggaagtgccgaatttaaacaattacaa
gtagaagcaggaggcaacggaagtcaatggggaactggtggtatggcaaccaaactcgct
gctgcacgtattgctacatcttcaggagttagaactgtcattactcagggaaagcaacca
caaaatattcttcaaattatccaaggagaacctttaggaacacaatttgaaccccaatca
agagcagataacgctcgcaagcgttggattaattatggtttaattcctatgggtaaattg
tatctagatcgtggtgctgttaaagctatttgtcaacaaggtaaatcattattgcctgcg
ggaattatcaaaatagaaggagattttgttgcttctgatgcagtgcaactgtgtgatgga
gaaggtagagaaattggcagaggcttagttaactatagcagtacagaaataactcaaatt
aaaggacaccattccgaaaaaattgcccaaattttaggttatgaaggagcagatactgta
gttcatcgcaataatttaatcattaaagattaa

DBGET integrated database retrieval system