KEGG   Stanieria cyanosphaera: Sta7437_3193Help
Entry
Sta7437_3193      CDS       T02406                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
scs  Stanieria cyanosphaera
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scs00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Sta7437_3193
Enzymes [BR:scs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Sta7437_3193
Exosome [BR:scs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sta7437_3193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3617449..3618957
Genome map
AA seq 502 aa AA seqDB search
MTNQTTQYILALDLGTTGNRAIIFDREGKVAGQTYQELTQYYPQPGWLEHDPNQIWQDTL
NCLQKVLANNQISASSVAAIGLTVQRETCLLWDKTTGRPLHKAIVWQDRRTAKLCNQLKE
QGKASEIQERTGLVLDAYFSATKLAWLLDWVKQNYSDINWDNVLAGTVDTWILWNLTGRK
VHATDHSNASRTMLMNLETLDWDEALLELFGIPRQIMPKIEPSIGSFGTTDPELIGAAIP
ITAIFGDQQAALFAHGCDRPGLLKCTYGTGCFLVAQAGEQITRSQNQLLATVAWTKQDGK
VHYALEGAMFTTGACIQWLRDGLKIIDSAAETDTLSRQVNDTNGVYFVPALSGLGAPHWD
MNARGAFLGITGGVKREHMVRAVLEAIAYQVKEVVDAINLDCDTPVSLLKVDGGVAQNDF
LMQFQADVLGIPVERPAVVDATAQGAAFGAGLAIGFWDDYSSLVSSSAVDQIFKPGKNSA
DAQANFKIWQKAVERSKNWIDQ
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgactaatcagacaactcaatacatcctcgctcttgacttaggaacgacaggcaaccgc
gcaattatttttgatcgagaagggaaagttgcaggtcaaacttatcaagaacttactcaa
tactatccccaaccaggatggcttgaacacgaccctaatcaaatttggcaagatacactt
aattgtctgcaaaaagttttagcaaataatcaaatctcggcttctagtgtagctgccatt
ggtttaactgtacagagagaaacttgtttactttgggataaaacaacaggtcgaccttta
cataaagctattgtttggcaggatcgtcgtacagctaaattgtgtaatcaattaaaagaa
caaggtaaagcatcagaaattcaagaaagaactggtttagttctcgatgcttatttttct
gctactaaacttgcttggttattagattgggttaaacaaaattattccgatattaattgg
gataatgttcttgctggaactgtagacacttggattctttggaatttaacaggaagaaaa
gttcacgccaccgatcatagtaacgccagtagaactatgttgatgaatttagaaactctc
gattgggatgaagctttattagaattatttggcattcctagacagattatgcccaaaatt
gaaccaagtataggtagttttggcacaactgatccagaactcatcggtgcagcaattcca
attacagcgatttttggcgaccaacaagcagccttatttgcccatggatgcgatcgccct
ggtttactaaaatgtacttatggtactggttgttttctagttgctcaagcaggagaacaa
attactcgctcacaaaatcaactacttgctacagtggcttggacgaaacaggatggtaaa
gtacattatgctttagaaggagcaatgtttaccacaggagcttgtattcaatggttgcgt
gatggattaaaaataattgattcggctgctgaaacagatactttatcccgtcaagtaaac
gatactaatggagtttatttcgttcctgctttaagtggtttgggcgcgcctcactgggat
atgaatgctcgcggagcatttttaggtattactggtggtgtcaaacgagaacacatggtc
agagcagttttagaagcgatcgcttatcaagtcaaagaggtggtagacgcgattaattta
gattgtgatacacctgtatcattattaaaagtcgatggtggtgttgctcaaaatgatttt
ttgatgcagtttcaagcagatgtcttgggtattcctgtagaacgtcctgctgtcgtagac
gctaccgcccaaggtgcagcttttggagcaggtttagcgattggtttctgggatgattat
agtagtttagtttctagtagtgcagtcgaccaaatttttaaaccaggtaaaaactcagca
gatgctcaagctaactttaaaatctggcaaaaagcagtagaacgctctaaaaactggatt
gatcagtga

DBGET integrated database retrieval system