KEGG   Stanieria cyanosphaera: Sta7437_3319Help
Entry
Sta7437_3319      CDS       T02406                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10 1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
scs  Stanieria cyanosphaera
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:scs00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Sta7437_3319
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sta7437_3319
   00620 Pyruvate metabolism
    Sta7437_3319
   00650 Butanoate metabolism
    Sta7437_3319
  Lipid metabolism
   00071 Fatty acid degradation
    Sta7437_3319
  Amino acid metabolism
   00350 Tyrosine metabolism
    Sta7437_3319
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sta7437_3319
   00626 Naphthalene degradation
    Sta7437_3319
Enzymes [BR:scs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Sta7437_3319
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Sta7437_3319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3754502..3757153
Genome map
AA seq 883 aa AA seqDB search
MQVTNLEQLETLIQKVKQAQQQYLTYTQEQVDHIFKKAALAANSARIPLAKMAVAETEMG
IVEDKVIKNHFASEIIYNKYKNAKTCGVIEEDKSFGFQKIAEPVGIIAGIVPTTNPTSTT
IFKALIALKTRNAIIFSPHPRAKQCTIEAAKVVLEAAVAAGAPENIIGWIDEPTVPLSQA
LMQHSEIKLILATGGPGMVKAAYSSGHPSLGVGAGNTPALIDSSAHIKMAVSSIILSKTF
DNGMICASEQSVVVVDDVYEQVKTEFITRGGYFVTPQEKDKLAQIIIVNGRLNSHIVGQP
VSKIAQLAGFTIPEGTRVILAEVEEIGFNEPFSQEKLAPILAMYRAKDFNQAVDKAQQLV
ELGGRGHTAALYTSIFESEHIKQFEDQVQASRVLINTPSSQGAIGDLYNFRLDPSLTLGC
GTWGGNSTSENVEPKHLLNIKTVAERRENMLWFRVPPKIYFKYGALPVAIRELAGKQRAF
IVTDQPIYNLGMTNSLENVLDEIGLKYEIFYDVEPDPSLDTVMAGLALMNSFNPDVIIAI
GGGSPMDAAKIMWLMYEHPEIEFEGLAMRFMDIRKRVYDLPPLGKKAILVAIPTTSGTGS
EVTPFAVVSDRRNKIKYPLADYALTPNMAIVDPELVLHMPKSLTAYGGIDALTHALEAYV
SVLASEYTNGLALEAIRLLFKYLPSAYQNGAKDPKAREKVHYAATIAGMAFANGFLGICH
SMAHQLGGTFHIPHGLANALMISHVIRYNATDAPFKQATFSQYKYPNAKWRYSRIADYLG
LGGNTEEEKTELLIQAVENLKRQLNIPLAMKDAINLNEAEFLVKLDEVADHAFDDQCTGT
NPRYPLINDLKRLLTDAYYGEISTTSNGKTSSNGHQTEMAVMN
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttaccaatctcgaacaactcgaaaccctaattcaaaaagtcaaacaagctcaa
caacaatatcttacctatactcaagaacaagtcgatcatattttcaaaaaagctgctcta
gctgctaactctgcccgcattccgttggcaaaaatggcggttgcagaaacagaaatggga
attgtcgaagacaaggtgattaaaaaccattttgcttcagaaattatctataacaaatac
aaaaacgccaaaacttgtggtgttatcgaagaagacaagtcttttggttttcaaaaaatt
gctgaaccagtagggattatagcaggaattgtccccactaccaatcctacctctactacg
atttttaaagctttgattgcccttaaaactcgtaatgctattattttttctcctcatcct
cgtgccaaacaatgcaccattgaagcagctaaagttgtcctcgaagcagcagtcgcagca
ggcgcaccagagaatattattggttggattgatgaaccaaccgtacctctctcccaagct
ttgatgcagcattcagaaattaagttaattttagcaacaggtggaccaggaatggtcaaa
gctgcatactcttctggtcatccttctttgggagtaggtgcaggtaatactccagcttta
attgattcttctgcccatattaaaatggcagtttcttcaattattctcagtaaaaccttc
gataacggcatgatttgcgccagcgaacaatcggtagtcgttgtagatgatgtttacgaa
caagtcaaaacggaatttattacccgtggtggttattttgtcactccacaagaaaaagac
aaattagcgcagataattatcgttaacgggcggttaaatagtcatattgttggtcaacca
gtctcgaaaatagctcaactcgcaggcttcacaattcctgagggaactagagtaattttg
gctgaagtagaagaaattggcttcaatgaacctttctcgcaggaaaaacttgctccgatt
ttagcaatgtatcgtgctaaagactttaaccaagcagtagacaaagcccaacaattagta
gaattaggtggtcgtgggcatacagcagccctttatacttcgatttttgaatcagaacat
attaaacaatttgaagatcaagtacaagcttctcgtgttttaattaatactccttcttct
caaggcgcaattggcgacctatataactttcgcctcgatccttccttgacgttgggttgt
ggcacttggggaggtaattccactagtgaaaatgttgaaccaaaacatttgttaaatatc
aagacagtggcagaaagaagagaaaatatgctctggtttcgcgtaccacccaaaatttac
ttcaaatatggtgcattacctgtagctattcgagaattggcaggaaaacaacgagccttt
attgtcacggatcaacccatctacaatctaggaatgactaattccttagaaaatgtcctc
gatgaaattgggttgaaatacgaaatcttttatgatgttgaaccagatccttccctcgat
acagtgatggcgggtttggcactgatgaatagcttcaatcctgatgtcattattgctatt
ggtggtggttcgcccatggatgctgccaaaatcatgtggttaatgtatgaacatcccgaa
attgaatttgaagggttagcaatgcggtttatggatatccgcaagcgagtctacgattta
ccgcctttagggaaaaaagctatcttagtggctattcccaccacctctggtacgggttca
gaagtaactccttttgccgtagtaagcgatcgccgtaataagattaaatatcctttggct
gattatgcccttactcccaatatggcaattgttgaccctgaattggtgttgcatatgcct
aagagtctcactgcttatggtggtattgatgctttaactcatgctttagaagcttatgtt
tcggttttagcttccgaatataccaacggactagcactagaagcaattcgtttactgttt
aaatatttacccagtgcttatcaaaatggggcaaaagaccctaaagctagggaaaaagtt
cattatgcagccaccatagcaggaatggcattcgccaacggatttttaggaatttgtcat
tcgatggcacatcagttgggaggaactttccatatccctcacggtttagctaatgcgcta
atgatttcccatgtcattcgttataacgctaccgacgcaccttttaaacaggcaactttt
tctcagtataagtatcctaatgctaaatggcgttattctcggattgctgattatttaggt
cttggcggtaatacagaagaagaaaaaaccgaattactaattcaagcagtagaaaacttg
aaacgtcagttgaatattcctctagccatgaaagatgcaattaaccttaatgaggcagaa
tttttggttaagctggatgaagtagctgaccacgcttttgacgatcaatgtacaggaaca
aatcctcgctatcctttgattaatgacctgaagcgacttttaaccgatgcttactatgga
gaaatttccaccacaagcaatggaaaaacaagcagtaatggtcatcaaaccgaaatggct
gtgatgaattag

DBGET integrated database retrieval system