KEGG   Stanieria cyanosphaera: Sta7437_3343Help
Entry
Sta7437_3343      CDS       T02406                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
scs  Stanieria cyanosphaera
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:scs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sta7437_3343
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sta7437_3343
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sta7437_3343
Enzymes [BR:scs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sta7437_3343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3784990..3786105
Genome map
AA seq 371 aa AA seqDB search
MTVSISAADLSEMPSMTRYSTNWPGLIEAYRPYLPVSDTTPVVTLLEGNTPLIPAPALSQ
AIGRGVQVYVKYDGLNPTGSFKDRGMTMAITKAKEAGAKAVICASTGNTSAAAAAYARRA
GMRAFVVIPDGYVALGKLAQALLYGAEVIAIEGNFDDALTIVRKMSENYPVTLVNSVNPY
RLQGQKTAAFEVVDVLGDAPDWLCIPVGNAGNITAYWMGFTEYHQQGKCARLPKMMGFQA
AGAAPFIAGKPIPNPETIATAIRIGNPANWEKAIAVQQHSQGEFHPVTDQEILEAYRLLA
SQEGIFCEPASAASVAGLLKQKEHLPNQATVVCVLTGNGLKDPSNAIEYSSNSIKQKIKA
DLKTVASEMGF
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtgactgtgagtatttctgctgctgatttatctgaaatgcctagtatgaccaggtattca
actaactggcctggtttaattgaagcttatcgtccttacttaccagtaagtgatactact
cctgtagttaccttactggagggtaatacacctctaattcctgcgcctgcgctctctcaa
gccattggtcgaggagtccaagtatatgtaaagtacgatgggcttaatccgactggtagc
tttaaagaccggggtatgactatggcgattaccaaagccaaagaagcaggagcaaaggct
gtaatttgcgctagcacaggaaatacttcagcagcagcagcagcttatgctcgtcgtgca
gggatgcgagctttcgtcgttattcctgacggttatgtagctttaggtaaattagcacaa
gctttactttatggtgcagaagtaattgcgattgaggggaattttgatgatgctttaact
atagtccggaaaatgtcggaaaattatcctgttactctagttaattcagtcaacccttat
cgtcttcaaggacaaaagactgctgcttttgaagttgttgatgttttaggtgatgctcct
gattggctctgtattcctgtgggaaatgctggtaacattaccgcctattggatgggtttt
actgaatatcatcaacaaggcaaatgcgctcgcttaccaaaaatgatgggttttcaagca
gcaggtgcagccccttttattgcaggtaaaccgattcccaatccagaaacgattgctacc
gcaattagaatcggaaatcccgctaattgggaaaaagcgatcgctgttcaacaacacagt
caaggtgaatttcatccagtaaccgaccaagaaatacttgaggcttatcgtttattagct
tcacaagaaggaattttttgtgaacctgctagtgctgcttctgttgctggattattaaaa
caaaaagaacatcttccaaatcaagcaactgtagtttgtgttctgaccggaaatggactt
aaagaccctagtaatgctattgaatatagcagtaactcgatcaagcagaaaatcaaagct
gatttgaaaactgtagctagtgaaatgggtttttaa

DBGET integrated database retrieval system