KEGG   Stanieria cyanosphaera: Sta7437_3486Help
Entry
Sta7437_3486      CDS       T02406                                 

Definition
cobaltochelatase CobN subunit (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
scs  Stanieria cyanosphaera
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:scs00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3939816..3943583
Genome map
AA seq 1255 aa AA seqDB search
MKRIVLIAGFESFNATLYRQAAQISTSRCNELEIEVFSDRDITSSSDKIENALQDADVFF
ASLIFDYDQVMWLRQRVEHIAIRLVFESALELMSLTRLGKFVIGDKPKGMPKPVQFILSK
FSNSREEDKLAGYLSFLKTGPKLLKYIPAKKVQDLRNWLIIYGYWNAGGTENVAAMFWTI
AEKYLGLKVGEIPSVIETPNMGLLHPDYPGYFTSPKDYLDWYQNHVGANHRSSLPTIGIL
LYRKHVITKQPYIPQLISYFEAEGLIPLPIFINGVEGHVAVRDWLTTNYEQLQREKDNKE
ILSLSENAVKVDAIISTIGFPLVGGPAGSMEAGRQVEVAKRILSAKNIPYIVAAPLLIQD
IHSWTRQGIGGLQSVVLYSLPELDGAIDTVPLGGLVGEDIYLIPERVKRLTGRIKNWIKL
KQTQPKDRKIAIILYDFPPGYGATGTAALLNVPKSLLNFLIALKEQGYNVGELPQDGEEI
INQVKQADTTDLHLSLENFTGNGIKTDGKGQVAINVRTLEKWLGYLLTTRVEKQWKSLTD
TGIKTYGDDFHLGGIQLGNIWIGVQPPLGLSGDPMRLMFEKDLTPHPQYAAFYKWLQNDF
QANAVVHFGMHGTVEWLPGSPLGNTGYSWSDILLGNLPNLYIYAANNPSESLLAKRRGYG
VLISHNVPPYGRAGLYKELISLRDLITEYRENTEKNYLLKDIICQKIIDTGLDADCKFTE
GEKLGIAFNVENAKLFSKKVINEYFVKIYEYLQVVEQRLFSSGLHVLGNAPNDEKLKSYL
EAYFGDDLSVELIELIIAHKDAEAQRIVETQHIASNQLEEAQKIRDLLEQNRDELTNLLR
GLNGEYIPPAPGGDLLRDGSGVLPTGRNIHALDPYRMPSPAAYERGKEIAKKIIAQHLEE
KGNYPETVAVMLWGLDAIKTKGESLGILLELVGAEPVKEGTGRIVRYELKSLAEIGHPRI
DVLANLSGIFRDTFVNIIELLDDLLQRAAEADESPEDNFIRKHYLALKSQGIENASARLF
SNPTGDFGSLVNDQVVDGNWESGEELANTWKNRNVFSYGRKDKGQARPEILNQLLQTSER
IVQEIDSVEYGLTDIQEYYGNTGGLKLAAEKQSGKQVEASFVESFSKDTNPRKLKDLLRL
EYRTKLLNPKWAEAMSNQGSGGAYEISQRMTALVGWGGTANFRDDWVYDQAADTYALDAE
MAAKLREANPEAFRNIVGRMIEAHGRGFWDADEEKLQKLRELYNLTEDELEGVTV
NT seq 3768 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggatcgtcttgattgctggatttgaatcatttaacgccaccttgtaccgtcaa
gctgcccaaatctctacatctcgttgtaatgaattagaaattgaagtatttagcgatcgc
gatattaccagttcctcggataaaatagaaaatgcgttacaagatgctgatgttttcttt
gctagtctgatctttgattacgatcaagtaatgtggttacggcaacgagtcgaacatatt
gcaattcggttagtttttgagtcagctttagagttaatgagtctgacacggttgggtaag
tttgtgattggtgataaacccaaaggaatgccgaaaccagtccaatttatcctgagtaag
tttagtaatagtcgagaagaagacaaacttgcaggttatctcagttttttaaaaacgggt
cccaaattacttaaatatattcctgctaaaaaagtccaagatttacgtaattggttaatt
atttatggttattggaatgcaggtggcacagaaaatgttgctgccatgttttggacaata
gctgagaaatatttaggtttaaaagtaggtgaaattccttcagtaattgaaaccccaaat
atgggtttattgcatcccgattaccctggatattttacctcacctaaagattatttggat
tggtatcaaaaccacgtaggggcgaaccaccgttcgtccttaccaacaattggtattctt
ttatatcgcaaacacgttattacgaaacaaccctatattccgcaattaattagttatttt
gaagctgaaggattaattcctttacctatatttattaacggcgtagaaggtcatgttgcg
gttagagattggttgactactaattatgaacaattacagcgagaaaaggataataaagaa
atactttccttatcagaaaatgcagtcaaagttgatgccataatttctacaattggtttt
cctttagttggcggccccgcaggttcaatggaagcaggaagacaagtagaagttgccaaa
agaattctttctgctaaaaatattccttatattgttgctgcacctttattaatccaagat
attcattcttggacaagacagggtattggtggtttacagagtgtagttttatattccttg
ccagaattagatggtgcgatcgatactgtacctttaggtgggttagtaggagaagatatt
tatttaattcctgaaagagtaaaaagattgacaggaagaataaaaaactggattaaacta
aagcaaactcaaccaaaagatcgcaagattgcaattattttatatgactttcctccaggt
tatggtgcaacaggaactgctgctttattaaatgttccaaaaagtttgcttaattttctg
atcgctttaaaagaacaaggctataatgtgggagaattacctcaagatggcgaagaaatt
attaatcaagtcaagcaagcagatacaaccgatttacatttatcattagaaaattttact
ggtaatggaattaaaactgatggtaaaggacaagtagctattaatgtccgtactttagaa
aaatggttgggttatttattaacaactagagtagaaaaacagtggaaatctttaacagat
actggcattaaaacctatggtgatgattttcatcttggtggcattcagttaggaaatatt
tggattggagttcaaccacctttaggactttctggcgaccctatgcgtttaatgtttgaa
aaagatttaactccccatcctcagtatgctgctttttataaatggttacaaaatgatttt
caagcaaatgccgttgttcattttggaatgcacggaactgtggaatggttacctggttca
ccattaggaaatacaggttattcttggtcagatattttactcggaaatctgcctaatctt
tatatttatgctgctaataatccctcggaatctctcttggcaaaaagaagaggttatgga
gttttaatttcccataatgtacctccttatggcagggctggtttgtataaagaattaatt
tctttacgggatttaattactgaatatcgagaaaatactgaaaaaaattatcttctgaaa
gatattatttgtcagaaaatcattgatactggtttagatgcggattgtaaatttacagaa
ggggaaaaattaggtattgcttttaatgttgaaaatgcaaaactgtttagtaaaaaagta
attaatgagtattttgttaaaatatatgagtatctacaagtagtagaacaaagattattt
tcttcagggttacacgtattaggaaacgcacctaatgatgaaaaactaaaatcttatttg
gaagcttattttggggatgatttatcggtagagttaattgagttaataatcgctcacaaa
gacgcggaggcacagagaattgtagagacgcaacatattgcgtctaatcaattagaagaa
gcacaaaaaattagagatttattagaacaaaatagggatgaattaaccaatcttttgcga
ggattaaatggtgaatatattcctcctgcacctggaggagatttattaagagatggttct
ggagttttacctactggtagaaatattcatgctttagatccttatcgaatgccttctcct
gctgcttatgaaagaggaaaagaaatcgctaaaaaaattattgcccaacatttagaagaa
aaaggtaattatcctgaaactgtagcagtaatgttatggggtttggatgcaattaaaact
aaaggtgaatctttaggaattttattagaattagttggggctgaacctgttaaggaggga
acaggaagaattgtccgttatgaattaaaatctttagcagaaattggacaccctcggatt
gatgttttggctaatctttcagggattttccgagatacttttgtcaatattattgagtta
ttagacgatttattacaacgggcagcagaagccgatgaatctccagaagataattttatt
cgcaagcattatttagctttaaaatctcaaggaattgagaatgcttctgcgcgacttttt
tctaatcctacgggagattttggttcgctagtaaatgaccaagttgttgatggaaattgg
gaatctggagaagaacttgctaatacttggaaaaatcgcaatgtctttagttacggacgc
aaagataaaggacaggcacgcccagaaattttaaatcaattattacaaactagtgaaaga
attgtgcaagaaatcgattcagttgaatacggtttaactgatattcaagaatattatggc
aatacgggaggattaaaattagctgcggaaaaacaaagtggtaagcaagttgaagcttct
tttgtagaaagcttttctaaagatactaatcctcgtaagttaaaagatttattgcgtcta
gaataccgcactaaattactcaatcccaaatgggcagaagccatgtctaatcaaggttct
ggtggtgcttatgaaatttctcaacgaatgacggctttagttggttggggtggtacagct
aattttagagatgattgggtttacgatcaagcagcagatacctatgcgttggatgcagag
atggctgccaagttacgggaagctaatcctgaagcgtttcgtaacattgtcggcagaatg
attgaggcacatgggcgcggtttttgggatgcagatgaagagaagttgcagaaattacga
gagttatacaacttgacagaagatgaattggaaggagttacagtataa

DBGET integrated database retrieval system