KEGG   Stanieria cyanosphaera: Sta7437_3747Help
Entry
Sta7437_3747      CDS       T02406                                 

Definition
GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
scs  Stanieria cyanosphaera
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sta7437_3747
Enzymes [BR:scs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Sta7437_3747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4241973..4242701
Genome map
AA seq 242 aa AA seqDB search
MTTVSSNGSNRSKSININSSNNLHSSLIEQVSSRPDRNTHNGQQAQIHAASEQAQEKMMA
AVRVMLESVGEDPEREGLLKTPKRVAEAMQFLTQGYNQSLEKIVNDAIFDEGHNEMVLVR
DISFFSLCEHHMLPFMGRAHVAYIPNQKVVGLSKLARIVEMYARRLQVQERLTRQIAEAI
QEVLEPQGVAVVMEATHMCMVMRGVEKPGSWTVTSAMLGAFQDEQKTRDEFLNLIRHQPS
FM
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagtttcttctaacggttctaatcgctcaaaatctatcaatattaatagttct
aataatcttcattccagtttgatagaacaagtttctagtagaccagatcgtaacactcac
aatggtcaacaagcccaaattcatgcagcatccgaacaagctcaagaaaaaatgatggct
gctgtccgagttatgttagagtctgtgggtgaagatccagagcgtgaaggactgctgaaa
acgcctaaaagagtagcagaagccatgcagtttctgactcaaggttataatcaatcctta
gaaaagattgttaacgatgcgatctttgatgaaggtcataatgaaatggttttggttaga
gatattagtttctttagcctttgtgaacaccatatgttgccttttatgggaagagcgcac
gttgcttatattcccaatcaaaaagtagttggtttaagtaaactagctcggattgttgaa
atgtatgctcgtcgtttgcaagttcaagaacgtcttacccgtcaaattgctgaagcaatt
caagaggtattagaacctcaaggagttgctgttgtcatggaagcaacccatatgtgtatg
gtaatgcgtggtgtagaaaagcctggttcttggacggttaccagcgcgatgttaggtgca
tttcaagacgagcaaaaaactcgcgatgaatttttgaatctaattcgtcatcaacctagt
ttcatgtaa

DBGET integrated database retrieval system