KEGG   Stanieria cyanosphaera: Sta7437_4348Help
Entry
Sta7437_4348      CDS       T02406                                 

Definition
Glucosylceramidase (EC:3.2.1.45)
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
scs  Stanieria cyanosphaera
Pathway
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scs00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Sta7437_4348
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Sta7437_4348
Enzymes [BR:scs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Sta7437_4348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4881636..4884050
Genome map
AA seq 804 aa AA seqDB search
MSANQTSLTQIPDCAWKRPLGKGWEKPYTVRYSSNLDDGAWHGMPLGGFGAGCIGRSHRG
DFNLWHLDGGEHVFRSLPACQFSVFESSEAKTQAYALCTEPPEDGTLSRWQWYPKEKGNY
HALYPRSWFEYQDVFQSQLTCEQFSPIWAENYQESSYPVAIFDWNVHNPTDKPITLSIML
TWQNTVGWFTNAIKSPTVKVRDDGSPVYEYQPKWGDSTGNFNQWIQDNYRVGCLLNRIQP
HAEIQEGEGQIAIATVTNPTLEVFYLSRWHPDGDGADVWDYFAADGSLPDRQDETPADPG
EQIASAIAVRFTVNPGKTRQIPFVLAWDLPVTEFAQGIKYYRRYTDFFGRTGNNAWSIVK
TALKHSDWWQESIQAWQEPILKRQDLPDWFKMALFNELYLLTQGGTLWSAATETDPIGQF
GVLECMDYRWYESLDVRLYGSFGLMMLWSKLDKSVLEAFARAIPKGDDTPRIIGYNRAQA
IRKAAGATPHDLGAPNEHPWQATNYTSYQDCNLWKDLPSDFVLQVYRDYVLTGSKDSEFL
WECWDSIVVTLAYLKEFDLDGDGIPENSGAPDQTFDDWRLQGISAYCGGLWIAALEAAIA
IGQILMTHPPMNPNLQPPDYPQGIETVINHYRVWLQQARSLYHDTLWNGEYYRLDSQSNS
DVVMADQLCGQFYARLLGLPDVVEEQYTKSALKKIYQACFLKFHNGKYGAANGVLPDGSP
VNPNDTHPLEVWTGINFGLAAFMLQMGMKAEAFQLTETVVKQVYENGLQFRTPEAITAVG
TFRASHYLRAMAIWGIYGILVDWK
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccaaccaaacatctttgactcagattcctgattgtgcttggaaacgtcctctc
ggtaaaggatgggaaaaaccttacacagttcgctacagcagtaatttggatgatggtgct
tggcatggaatgcctttaggtggttttggtgcgggttgtatcggtcgttctcatcgcggt
gattttaatctttggcatctggatggtggtgaacacgtttttcgttctcttcctgcttgt
caatttagtgtatttgaaagctcggaagctaaaactcaagcttatgctctctgtaccgaa
cctcctgaagatggaactttatctcgttggcaatggtatccgaaagaaaaaggaaactat
cacgctctttatcctcgcagttggtttgaataccaggatgtttttcaatctcaattgact
tgtgaacagttttctccgatttgggcagaaaattatcaggaaagtagttatcctgtcgct
atttttgactggaatgttcataatcccacagataagccgattacgcttagtattatgctg
acttggcaaaatacggttggttggtttaccaatgcgattaaatctcccactgtgaaagtc
agggatgatggtagtccagtttatgaatatcaacccaaatggggagatagtacgggaaac
tttaatcaatggattcaagataactatcgcgttggttgtttactcaatcgcattcaaccc
catgcagaaattcaggaaggtgaaggacaaattgcgatcgcgactgtaactaatccaact
ttagaagtattttatctcagtcgttggcatcctgatggtgatggtgcagatgtttgggat
tattttgcagcagatggttctttaccagataggcaagatgaaacccctgcagatcctggg
gaacaaattgcctctgcgatcgcagtacgttttacggttaatccaggtaaaactcgtcaa
ataccttttgttttagcttgggatttgcctgtaacagaatttgctcaaggaattaaatat
tatcgtcgctacacggatttttttggacgtactggtaataatgcctggagtattgttaaa
actgctttaaaacacagcgattggtggcaagaaagtattcaagcttggcaagaaccgatt
ttaaaacgtcaagatttgccagattggttcaaaatggcgttatttaatgaattatacttg
cttacccaaggtggtactctttggagtgcagcaaccgaaaccgatcctatcggacaattt
ggggtactagagtgcatggactatcgttggtatgaaagtcttgatgtgcgtctgtatggt
tcgtttggtttaatgatgttatggtcgaagctagataagtcggttttagaagcttttgct
agagcgattccgaaaggagatgatactcctcgtattattggttataatcgggcgcaagcg
attcgtaaagcagcaggagcaactcctcacgatctcggcgcacctaacgaacatccttgg
caagctactaactacacttcctatcaagattgtaatctgtggaaagatttaccaagtgat
tttgttctacaagtatatcgagattatgtactaacaggatcaaaagacagcgagtttctc
tgggaatgctgggatagtattgttgtcactttggcatatcttaaagaattcgatctcgat
ggagatggtattcctgaaaactctggcgcaccagatcaaacctttgatgattggagatta
caaggaattagtgcctattgtggtggtttgtggatagctgccttagaagctgcgatcgca
attggtcagattttaatgactcatcctcccatgaatcctaatttacaaccaccagactat
cctcaaggtattgaaactgtaattaatcattatcgagtatggttacaacaggcgcgatcg
ctttatcatgatactttgtggaatggtgagtattaccgtcttgatagtcaaagtaattct
gatgtagtgatggcggatcaactttgtggtcaattttacgccagattattaggattacct
gatgtcgtcgaagaacaatacactaaatctgctttgaagaaaatttatcaggcttgtttc
ctaaagtttcataatggcaaatatggcgcagcaaacggagttttacctgatggtagtcca
gtaaatcctaatgatactcatccgttggaagtatggacgggaattaattttggtttggca
gcttttatgttgcaaatgggaatgaaagcagaggcgtttcaactaacagaaactgtggta
aaacaagtatatgaaaatggtttacaatttcgtactcctgaagcaattactgcggttggt
actttccgcgctagtcattatttaagagcaatggcgatttggggtatttatggaatttta
gttgattggaagtaa

DBGET integrated database retrieval system