KEGG   Stanieria cyanosphaera: Sta7437_4439Help
Entry
Sta7437_4439      CDS       T02406                                 

Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
scs  Stanieria cyanosphaera
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:scs00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:scs00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4986300..4987640)
Genome map
AA seq 446 aa AA seqDB search
MSLEDKAINLSLKLTQTPLVSAEDQPRLKIVGKASLQGEVKISGAKNSALVLMAGSLLCE
GDSQLHNVPDLVDIKRMSELLKALGVKIVKKDNIFEINATDIDPTKAPYDIVSQLRASFF
IIGPLLSRFGVVRIPLPGGCAIGARPVDLHVRGLQAMGANVRIESGIVHANVVGRNRRLQ
GANIFLDYPSVGATETIMMAATLAEGETKIENAAQEPEVVDLANFCCQMGAKISGAGTNT
IIISGVKNLYPVKYSVIPDRIEAGTFLVAGAITRSEISLYPVIAEHLAPVIAKLQDIGCQ
VIAEEAERLRIIPGQLKATDLETLPYPGFPTDMQAQFMALLSISEGNSVVSETVFENRLR
HVAELSRMGADIRVKSNHALIRGVPFLSGAPVMASDLRASAALVLAGLAAEGTTIVSGLH
HLDRGYDNIEGKLRQLGATLERINPT
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
ttgagtttggaggataaagccattaacctatctctaaaattaacacaaactccacttgtc
tcagcagaagaccaaccccgattaaaaattgttggtaaagcatctctgcaaggagaagta
aaaattagtggagccaaaaactctgctttggtactcatggcagggtcattgctgtgtgag
ggagattctcaactccataatgtacctgatctagtagatattaagcgaatgagcgagctt
cttaaagctctaggtgtaaaaattgttaaaaaagacaatatctttgagattaacgctact
gatattgatcccactaaagctccttacgacatcgtatcccaattaagagcaagttttttt
attattggtcctttactcagtcgatttggtgtagttcgcattcccctaccaggaggttgt
gctattggagctagaccggtagacctccacgtccgaggtttacaagcaatgggagctaat
gttcgcattgagtcgggaattgttcatgccaatgtggttggtagaaatagaagacttcaa
ggagctaatatttttcttgactatcctagtgttggtgctaccgaaaccattatgatggca
gcaactctagcagaaggagaaaccaaaattgaaaatgctgcacaagaaccagaagtagtc
gatttagctaacttttgttgtcaaatgggcgcaaaaattagcggtgcaggaactaataca
attattatttctggagttaaaaacttatatcctgtaaaatatagtgttattcccgatcgc
attgaagcaggaacattcttagtcgcaggagcaattactcgttcagaaatatccttatat
ccagtcattgccgaacatttagccccagttatcgccaaattacaagatatcggttgtcaa
gttattgctgaagaagcagaacgtttgcgaattattcctgggcaattaaaagcaaccgat
cttgaaactctgccttatccaggatttcctaccgatatgcaggcacaattcatggcttta
cttagtattagtgaaggcaatagtgtcgtcagtgaaaccgtttttgaaaatcgtcttcgt
catgttgccgagttaagtcgaatgggtgcagatattcgagttaaaagcaaccatgcttta
attcggggtgttccgtttctctctggtgcgccagtcatggcaagcgatttacgcgcctct
gctgccttggttttagcgggattagcagccgagggaacaactattgtctcgggtttacat
catctcgaccgaggctatgacaatatcgaaggaaaattacgacaactaggagcaacactc
gaacgaattaatcctacttga

DBGET integrated database retrieval system