KEGG   Streptomyces cattleya NRRL 8057: SCAT_0081Help
Entry
SCAT_0081         CDS       T01646                                 

Gene name
treS
Definition
Trehalose synthase
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCAT_0081 (treS)
Enzymes [BR:sct01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SCAT_0081 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     SCAT_0081 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(82901..84652)
Genome map
AA seq 583 aa AA seqDB search
MSTPTSSPLAPVAAPLPGGLPRTTTALAPAPEWFKRAVFYEVLVRAFHDSDGDGIGDLGG
LTAKLDYLRWLGVDCLWLPPFFASPLRDGGYDVSDHRAIHPDTGTVEDFAELLRAAHRHG
MRVIIDFVMNHTSDQHPWFQASRTDPDGPYGDYYVWADDDTRYRDARVIFVDTETSNWTF
DPVRKQYFWHRFFSHQPDLNYDNPAVQEEILAALRFWLDLGVDGFRLDAVPYLYAEEGTT
CENLPRTHEFLKRVRRLVDTEYPGRVLLAEANQWPEDVVDYFGDYSVGGDECHMAFHFPV
MPRIFMAVRRENHHPVSEILAKTPPIPSGCQWGIFLRNHDELTLEMVTDEERDYMYDQYV
KDPRMRANIGIRRRLAPLLDNDRDQIELVNALLLSLPGSPILYYGDEIGMGDNIWLGDRD
AVRTPMQWTPDRNAGFSSANPARLYLPAITDPVHGYQAVNVEAQMAGPSSLLHWTRRMLG
LRRRHPAFGLGDFEEVPSSNPAVFAYRRRHVAEDGTRSTVLCVNNFSRHPQPAELSLGAY
LGTTPVEITGDVPFPPVVTDAYRLSLKGHGFYWFALLPSEDVL
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
ttgagcacgcccacgtcgtcaccgctcgccccggtggccgcgccgctccccggcggcctg
ccccgtaccaccaccgccctcgccccggcacccgagtggttcaaacgggccgtcttctac
gaggtcctggtgcgggccttccacgacagcgacggcgacggcatcggcgatctgggcggt
ctcaccgccaagctggactacctgcgctggctcggggtggactgcctgtggctgccgccc
ttcttcgcctccccgttgcgtgacggcggctacgacgtctccgaccaccgcgcgatccac
cccgacaccggcaccgtcgaggacttcgccgaactgctgcgcgccgcccaccggcacggc
atgcgcgtgatcatcgacttcgtgatgaaccacaccagcgaccagcacccgtggttccag
gcctcccgcaccgaccccgacggcccctacggcgactactacgtctgggccgacgacgac
accaggtaccgcgacgcccgcgtcatcttcgtcgacaccgagacctccaactggaccttc
gacccggtgcgcaagcagtacttctggcaccggttcttctcccaccagcccgacctcaac
tacgacaacccggcggtgcaggaggagatcctggccgcgctgcggttctggctcgacctc
ggggtggacggcttccggctggacgcggtgccctacctgtacgccgaggagggcaccacc
tgcgagaacctgccgcgcacccacgagttcctcaagcgggtgcgccgcctggtggacacc
gagtaccccggccgggtgctgctggccgaggccaaccagtggccggaggacgtggtcgac
tacttcggcgactactcggtcggcggcgacgaatgccacatggccttccacttccccgtc
atgccgcgcatcttcatggcggtgcgccgcgagaaccaccacccggtctccgagatcctc
gccaagacgccgccgatcccttccggctgccagtggggcatcttcctgcgcaaccacgac
gagctgacgctggagatggtcaccgacgaggaacgcgactacatgtacgaccagtacgtc
aaggacccccggatgcgcgccaacatcggcatccgccgccgcctcgccccgctgctggac
aacgaccgcgaccagatcgaactcgtcaacgccctgctgctgtcgctgcccggctcgccc
atcctgtactacggcgacgagatcggcatgggcgacaacatctggctcggcgaccgggac
gcggtacgcacccccatgcagtggacccccgaccgcaacgccggcttctcctcggccaac
ccggcccgcctctacctgcccgccatcaccgatccggtccacggctaccaggcggtcaac
gtcgaggcgcagatggccgggcccagctcgctgctgcactggacgcgccggatgctcggg
ctgcgccggcgccatccggcgttcggactcggcgacttcgaggaggtgccctcctccaac
ccggcggtcttcgcctaccgccgccgccacgtcgccgaggacggcacccgctccacggtg
ctgtgcgtcaacaacttctcccgccatccgcagcccgccgaactctcgctcggcgcctac
ctggggaccaccccggtggagatcaccggtgacgtgccgttccccccggtggtcaccgac
gcctaccggctcagcctcaagggccacgggttctactggttcgcgctgctgccgtcggag
gacgtgctgtga

DBGET integrated database retrieval system