KEGG   Streptomyces cattleya NRRL 8057: SCAT_0144Help
Entry
SCAT_0144         CDS       T01646                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAT_0144
   00052 Galactose metabolism
    SCAT_0144
Enzymes [BR:sct01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SCAT_0144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
199794..200927
Genome map
AA seq 377 aa AA seqDB search
MAACTAVREALPVTAHESPVERWTLRSPSGVQASVLSFGAVLQSLRVPDAAGTAVDDIVL
RLAGPREYAGHGSYLGAVVGRYANRIAGGTFHLDGVVHRVPANDRGNALHGGPDGFDQRV
WQASPVPCADGSTGVRMTLDSPDGDQGFPGRLTATVDYVLRTDGTLVIDYSARTDRPTVA
NLTHHAYFNLTGRPEKGVLGHVLTVDADTYLPIDDTAIPLPGAPEPVRGTPFDFTGPQTL
GGRIGTPHPQLATAGGYDHCWVLRGHAASHAPDARENAPTRPLVPHRAARLEEPRSGRVM
EVRTTEPGLQVYSGQQLDGTLRDAEGRPLTPHAGVCLETQHFPDSPNRPDYPSTVLRPDR
PLRSRTEFSFPHLRACG
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctgcacagcagttcgcgaggctctgcccgtcaccgcgcacgagtcgccggtg
gaacgctggacgcttcgctcccccagcggggtccaggcctccgtgctcagcttcggagcc
gtcctccagtcactgcgcgtgccggacgccgccgggaccgcggtggacgacatcgtgctg
cgcctggcaggcccccgggagtacgccggtcacggttcctacctcggggcggtcgtcgga
cggtacgccaaccgcatcgccgggggcacgttccacctggacggggtggtgcaccgcgtc
cccgccaacgaccggggcaacgcgctgcacggcggccccgacggcttcgaccagcgcgtg
tggcaggcgagtcctgttccctgcgccgacggctcgacgggcgtgcggatgaccctcgac
agtccggacggcgaccaggggttcccggggcgcctcaccgccacggtcgactacgtcctg
cgcacggacggcaccctcgtcatcgactactcggcccgcaccgaccgcccgacggtggcc
aacctgacgcaccacgcgtacttcaacctcaccgggcggcccgaaaaaggcgtgctgggc
cacgtcctcaccgtcgacgccgacacgtatctgccgatcgacgacaccgcgatccccctg
ccgggcgcgccggagccggtgcgaggcaccccgttcgacttcaccggcccgcagacgctg
gggggacgcatcggtacaccgcacccccaactcgccacggcgggcgggtacgaccactgc
tgggtcctgcgcggccacgcggcaagccatgccccggacgcccgggagaacgcacccacg
cgcccactcgtcccgcaccgggccgcgcgtctggaggagccgcgcagcggccgggtcatg
gaggtccgcaccaccgaaccgggtttgcaggtctacagcggacagcagttggacggcacg
ctccgggacgccgaaggacggccgctcaccccgcacgcgggcgtgtgcctggagacccag
cacttcccggactcgcccaaccgcccggactaccccagcacggtgctccggccggaccgg
ccgctgcgcagccgtacggagttctccttcccgcacctgagagcctgtgggtga

DBGET integrated database retrieval system