KEGG   Streptomyces cattleya NRRL 8057: SCAT_0266Help
Entry
SCAT_0266         CDS       T01646                                 

Definition
theronine dehydrogenase-like Zn-dependent dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sct01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:sct00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:sct00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(323024..324190)
Genome map
AA seq 388 aa AA seqDB search
MVYEGTRRVGVHEVEDAVVEEPTDVVVRITSSAMCGTDLHMYDGRTGARPGLVLGHEPLG
VVEKAGPAVTMVAPGDRVVMPTHLYCGVCPTCARGLTAACTRVRPGGFGAAYGYAGMGPY
RGAQAELLRVPYADANCMPLPGSPGDAYEDAFVLLADAFVTGWHACELAGTGPGDSVAVF
GAGAVGLLAAHSAVLRGAAEVYVVDHLPERLAVAADFGALPVDTRDGDPGEQIRSLRNSG
GGMPPGEAGLDGVTCGIDAVGFQARSRADLDQEDPRQVIDDLAAIVNPTGRIGVAGVFAA
HDAHPAPHGHADGTLQVPWAVLFDKGVRVGFGRTHDRRYTRLLRDLILTGRAEPQRVVTH
HGPLEDAPAFYTAFDRREDGVIKAVLHP
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtggtctacgaaggcacccggcgggtcggcgtgcacgaggtcgaggacgccgtcgtcgag
gaacccaccgacgtggtcgtccgcatcacctccagcgcgatgtgcggcaccgacctgcac
atgtacgacggccgcaccggcgcccgccccggactggtgctcggccacgaaccgctgggc
gtggtggagaaggccggacccgcggtgaccatggtcgcccccggcgaccgcgtggtgatg
cccacccatctgtactgcggcgtctgccccacctgcgcccgcggcctgaccgccgcctgc
acccgggtacgccccggcggcttcggcgccgcctacggctacgccgggatgggcccctac
cgcggcgcccaggccgaactgctgcgggtgccctacgccgacgccaactgcatgccactg
cccggctccccgggcgacgcctacgaggacgccttcgtgctgctcgccgacgccttcgtc
accggctggcacgcctgcgaactggccggcaccggacccggcgacagcgtggccgtcttc
ggcgccggcgcggtggggctgctggccgcccactccgcggtgctgcgcggcgccgccgag
gtgtacgtcgtcgaccacctgcccgaacgcctcgcggtcgccgcggacttcggcgcgctg
ccggtcgacacccgggacggcgaccccggcgagcagatccgctcgctgcgcaactccggc
ggcggcatgccccccggcgaggccggactcgacggggtgacctgcggcatcgacgccgtc
ggcttccaggcccgcagccgcgccgacctcgaccaggaggacccccgccaggtgatcgac
gacctggccgccatcgtcaaccccaccggccggatcggcgtcgccggggtcttcgccgcc
cacgacgcccacccggcgccgcacggccacgccgacggcacgctccaggtgccgtgggcc
gtcctgttcgacaagggcgtccgcgtcggcttcggccgcacccacgaccgccgctacacc
cgcctgctgcgcgacctgatcctcaccggccgcgccgaaccccagcgtgtcgtcacccac
cacggcccgctggaggacgcccccgccttctacaccgccttcgaccgccgtgaggacggc
gtgatcaaagcggtgctccacccctga

DBGET integrated database retrieval system