KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_0328Help
Entry
SCAT_0328         CDS       T01646                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase 3
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAT_0328 (pfkA)
   00030 Pentose phosphate pathway
    SCAT_0328 (pfkA)
   00051 Fructose and mannose metabolism
    SCAT_0328 (pfkA)
   00052 Galactose metabolism
    SCAT_0328 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SCAT_0328 (pfkA)
Enzymes [BR:sct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SCAT_0328 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     SCAT_0328 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
391696..392721
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTSGGDCPGLNAVIRSVVHRAVADHGDEVIGFHDGWKGLLECDYRKLDLDAVSGI
LARGGTILGSSRVQPAHLRDGVERARGHVDELGLDAIIPIGGEGTLKAARLLSDAGLPIV
GVPKTIDNDIASTDVTFGFDTAVMVATEALDRLKTTAESHQRVLIVEVMGRHTGWIALHA
GMAAGAHAIVVPERPFDITELTEVVRKRFEAGKKFAIVVVSEGAKPREGTMEFESGRTDV
YGHERFAGVARQLSVELEDRLGKEARPVILGHVQRGGTPTAYDRVLATRFGWHAVEAAHN
GDFGMMTALRGTDITLVPLAEAVEHLKTVPVERYIEAECVL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattggtgtgctgaccagcggcggcgactgccccggactgaacgccgtcatccgg
tcggtggtgcaccgcgccgtggccgaccacggtgacgaggtgatcggcttccacgacggc
tggaagggcctgctggagtgcgactaccgcaagctggacctggacgccgtcagcggcatc
ctggcccgcggcggcaccatcctgggctcctcccgggtgcagccggcccacctgcgggac
ggcgtggagcgggcccgggggcacgtcgacgagctgggcctggacgccatcatcccgatc
ggcggcgagggcacgctcaaggcggcccggctgctgtccgacgcggggctgccgatcgtc
ggggtgcccaagaccatcgacaacgacatcgcctccaccgatgtcaccttcggcttcgac
accgcggtgatggtggccaccgaggcgctggaccggctgaagaccaccgccgagtcccac
cagcgggtgctcatcgtcgaggtgatggggcgccacaccgggtggatcgcgctgcacgcc
gggatggcggcgggcgcccacgccatcgtggtcccggagcggccgttcgacatcaccgag
ctgaccgaggtggtccgcaagcggttcgaggcgggcaagaagttcgccatcgtggtggtc
tccgagggcgccaagccgcgtgagggcacgatggagttcgagagcggccgtaccgacgtc
tacggccacgagcggttcgccggggtggcccggcagctctcggtggagctggaggaccgc
ctgggcaaggaggcccggccggtgatcctcggccatgtgcagcgtggcggcaccccgacc
gcgtacgacagggtgctggccacccggttcggctggcacgcggtggaggcggcgcacaac
ggcgacttcggcatgatgaccgcgctgcgcggcaccgacatcaccctggtgccgctggcc
gaggcggtggagcacctcaagacggtcccggtggagcggtacatcgaggccgaatgcgtg
ctgtga

DBGET integrated database retrieval system