KEGG   Streptomyces cattleya NRRL 8057: SCAT_0810Help
Entry
SCAT_0810         CDS       T01646                                 

Definition
ROK-family transcriptional regulator
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCAT_0810
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAT_0810
   00052 Galactose metabolism
    SCAT_0810
   00500 Starch and sucrose metabolism
    SCAT_0810
   00520 Amino sugar and nucleotide sugar metabolism
    SCAT_0810
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SCAT_0810
   00524 Butirosin and neomycin biosynthesis
    SCAT_0810
Enzymes [BR:sct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SCAT_0810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(902278..903255)
Genome map
AA seq 325 aa AA seqDB search
MHSEGAAGRESAAGGLVMALDIGGTKIAGALVDSDGTLVTRALRPTPATEDAGTVMGAVE
EVLAELAADPRRGLVTAVGIGSAGPVDASAGTVSPVNVPGWRGFPLVDAVRKATGGLPVV
LTGDGVAIAAAEHWQGAARGYRNALCMVVSTGVGGGFVLGGALHPGPTGNAGHIGHISVD
LDGDPCPCGARGCVERIASGPNIARRALEGGWRPKEGQEPTAAAVAEAARAGDPVARASF
DRAAQALAAGIAAAATLVEIEVAVVGGGVAGAGPVLFDPLRAHLRRYATLSFASAVTVLP
AHLGTDAGLVGAAAAAFGVAAGGGG
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcacagcgaaggagcggcggggcgcgagtcggctgccggggggctcgtcatggctctg
gacatcggcggcaccaagatcgccggcgccctggtcgacagcgacggcacgctggtgacg
cgggcgctgcgccccaccccggccaccgaggacgccggcacggtgatgggcgcggtcgag
gaggtcctcgccgagctcgccgccgacccgcgacgcggcctggtgaccgccgtcggcatc
ggcagcgccggcccggtggacgcctcggccggcaccgtcagcccggtcaacgtgcccggc
tggcgcggcttcccgctggtggacgcggtccgcaaggccaccggagggctccccgtcgtc
ctcaccggggacggggtcgccatcgccgccgccgaacactggcagggcgccgcccgcggt
taccgcaacgccctgtgcatggtggtctccaccggcgtcggcggcggattcgtcctgggc
ggcgcgctccaccccggccccaccggcaacgccggccacatcggccacatcagcgtcgac
ctggacggcgacccctgcccgtgcggtgcccgtggctgcgtcgaacggatcgccagcggc
cccaacatcgcccgccgcgccctggagggcggctggcggccgaaggagggccaggagccg
accgccgccgcggtggccgaggccgcccgggccggcgacccggtggcccgcgcctccttc
gaccgcgcggcgcaggcgctcgcggccggcatcgcggcggcggccaccctcgtcgagatc
gaggtcgccgtcgtcggcggcggcgtcgccggcgccggccccgtcctcttcgaccccctc
cgcgcccacctgcgccgctacgccaccctctccttcgcctccgccgtcaccgtcctcccc
gcccacctcggcaccgacgccggcctggtgggcgccgccgcggcagcgttcggcgtggcg
gccgggggaggtgggtga

DBGET integrated database retrieval system