KEGG   Streptomyces cattleya NRRL 8057: SCAT_1042Help
Entry
SCAT_1042         CDS       T01646                                 

Definition
aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SCAT_1042
Enzymes [BR:sct01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SCAT_1042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1127351..1128001)
Genome map
AA seq 216 aa AA seqDB search
MDWYKDLDDAWRDLVAVARRTAADGLVVGTSGNVSVRVGDLVLVTPSGVHYDRLRQRDLT
AVDLSGKQRFGRLRPTSEVPMHLAVYRETDARAMVHTHAAHATAVSTLVDEVPPVHYICA
ALGGPVRVARYATFGSPELADAMLEALRDRTGCLLRNHGTVVTGRTLDEAYDNTRQLEWM
CRVWLAAAAVGTPAVLSPAELAEAGHELRHYGQSQR
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggactggtacaaggacctcgacgacgcctggcgcgacctcgtggccgtcgcccgccgg
accgcggcggacggcctggtggtcggcacctccggcaacgtctcggtgcgcgtcggcgac
ctggtgctggtcaccccgagcggggtgcactacgaccggctccggcagcgggacctcacc
gccgtcgacctctccggcaagcagcggttcggccggctccgccccaccagcgaggtcccg
atgcacctggcggtctaccgggagaccgacgcccgggccatggtgcacacccacgccgcc
cacgccaccgccgtctccaccctggtggacgaggtccccccggtccactacatctgcgcc
gccctcggcggaccggtacgcgtcgcccgctacgccaccttcggctccccggaactcgcc
gacgccatgctggaggcgctgcgcgaccgcaccggctgcctgctgcgcaaccacggcacc
gtggtgaccggccgcaccctggacgaggcgtacgacaacacccggcagctggaatggatg
tgccgggtctggctcgccgccgcggccgtcggcaccccggccgtgctctccccggccgaa
ctggccgaggccggccatgaactacgccattacgggcagtcgcaacggtag

DBGET integrated database retrieval system