KEGG   Streptomyces cattleya NRRL 8057: SCAT_1049Help
Entry
SCAT_1049         CDS       T01646                                 

Definition
hypothetical protein
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SCAT_1049
Enzymes [BR:sct01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     SCAT_1049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1137724..1139781
Genome map
AA seq 685 aa AA seqDB search
MSTTTPYPFTAIVGMADLRLALLLNAVSPAVGGVLVRGEKGTAKSTAVRALSALMPPVEV
VPGCRFSCDPAAPDPGCPDGPHPADAGGATRAARMVELPVGASEDRLVGALDIERALAEG
KKAFEPGLLAAAHRGLLYVDEVNLLHDALVDLLLDAAAMGACYVEREGVSVRHAARFLLV
GTMNPEEGELRPQLLDRFGLTVEVAASREADERVEVVRRRLAYDDDPAAFAARWAAEEEA
LRERIAAARALLPSVVLGDAALRQIAAVCAAFDVDGMRADIVTARTATALAAWAGRTQVL
AEDVRQAALLALPHRRRRNPFDAPGLDERQLDDTLREFGGDDDPDPDGPDGPDGPGGGGP
DGPGGQPPRESGEDDGQSPPPSPSPTPGPGEATGNEAAEGEPRGAGSGGGEQAAAPAGEP
FKARTLTVAGLGDGAAGRRSRARTDHGRTIGARRPQGPLTRLHLAATVHAAAPHQRARGR
SGPGLVLRKDDLRQAVREGREGNLVLFVVDASGSMAARQRMTAVKGAVLSLLLDAYQRRD
KVGLITFRGTGAELALPPTSSVEVGAARLERLPTGGRTPLAAGLAKAREVLRVERLRDPA
RRPLLLVVTDGRATGGPEPVALATRAARQLAADQVASVVVDCESGPVRLGLAGALARDLA
GTAVTLEELRADTVSAVVRDARRAA
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccaccaccccttacccgttcacggcgatcgtcgggatggccgatctgcggctg
gcgctgctgctcaacgccgtctccccggcggtgggcggggtgctggtgcgcggtgagaag
gggaccgccaagtcgaccgcggtacgggcgctgtcggccctgatgccgccggtcgaggtg
gtccccgggtgccgtttctcgtgcgacccggcggcgcccgacccgggctgcccggacggc
ccgcacccggcggacgcgggcggcgcgacccgtgcggcccgcatggtcgagctgccggtc
ggcgcctcggaggaccggctcgtcggcgccctggacatcgaacgcgccctcgccgagggg
aagaaggccttcgagccgggcctgctggccgcggcccaccgcgggctgctctacgtcgac
gaggtcaacctgctgcacgacgcgctggtcgacctgctgctggacgccgccgcgatgggc
gcctgctacgtggagcgggagggcgtctcggtgcgccacgcggcccgcttcctgctggtg
ggcacgatgaacccggaggagggcgagctgcgtccgcagctgctggaccgcttcgggctc
accgtggaggtggccgcctcgcgggaggcggacgagcgggtcgaggtggtgcgccgccgg
ctcgcctacgacgacgacccggccgccttcgcggcgcgctgggcggccgaggaggaggcg
ctgcgcgagcggatcgccgcggcgcgggcgctgctgccgtcggtggtgctcggtgacgcg
gcgctgcgccagatcgccgcggtgtgcgccgcgttcgacgtggacgggatgcgcgccgac
atcgtcaccgcccgtaccgccaccgcgctggccgcctgggcgggccgcacccaggtgctc
gccgaggacgtgcggcaggccgcgctgctggcgctgccgcaccggcgccgccgcaacccg
ttcgacgcgccgggcctggacgagcggcaactcgacgacaccttgcgggagttcggcggc
gacgacgacccggacccggacggaccggacggccccgacgggccgggcggcggcgggccg
gacggccccggcggacagcccccgcgcgagtccggggaggacgacggccagtcgccaccg
ccctccccctcccccacgcccggaccgggcgaggcgaccgggaacgaggcggccgagggc
gagccgcgcggcgcgggcagcggcggcggtgagcaggcggcggccccggccggagagccg
ttcaaggcccgcaccctgaccgtggccggcctcggcgacggggcggccgggcggcgttcc
cgggcccgtaccgaccatggccgcaccatcggcgcccgccgcccgcagggcccgctcacc
cggctccacctggccgccaccgtgcacgccgccgcgccgcaccagcgcgcccggggccgc
agcggaccggggctggtgctgcgcaaggacgacctgcgccaggcggtgcgcgagggccgc
gagggcaacctggtgctcttcgtggtggacgcctccggctcgatggcggcccggcagcgg
atgacggccgtcaagggcgccgtgctctccttgctgctcgacgcctaccagcggcgcgac
aaggtggggctgatcaccttccggggcaccggcgccgagctggcgctgccgcccacctcg
tcggtggaggtcggggccgcccggctggagcggctgcccaccggtggccgtaccccgctg
gccgccgggctcgccaaggcccgggaggtgctgcgggtggagcggctgcgggatccggca
cggcgcccgctgctgctggtggtgaccgacggccgggccaccggcgggccggaaccggtg
gcgctggccacccgggccgcccggcagctcgccgccgaccaggtggcctcggtggtggtg
gactgcgagtccgggccggtgcggctgggtctggcgggcgcgctcgcccgcgacctggcg
ggcaccgcggtgacgctggaggagttgcgcgcggacaccgtgtccgccgtggtacgggac
gcgaggagggccgcgtaa

DBGET integrated database retrieval system