KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_1156Help
Entry
SCAT_1156         CDS       T01646                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCAT_1156 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCAT_1156 (trpA)
Enzymes [BR:sct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SCAT_1156 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1270814..1271641)
Genome map
AA seq 275 aa AA seqDB search
MSGNLGLLEKTLAAAKAEDRAALIGYLPAGFPSVEGGVDAAIAMVEGGCDIVEIGLPHSD
PVLDGPVIQTADDIALRGGVKIADVLETVRRVHAATGAPVLCMTYWNPVDRHGAERFAEE
LAAAGGAGCILPDLPVEESAQWRAAAGRHGLATVFVVAPSSRDERLAEITAAGSGFVYAA
SLMGVTGTRASVGAQAADLVRRTRATPAGRQGLPVCVGLGVSNGEQAAEVAAFADGVIVG
SAFVKRLLDSADRETGLAGLRDLAGELAAGVRKRG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcaacctcgggctgttggagaagacgctggccgccgccaaggcggaggaccgg
gccgcgctcatcggctacctgccggccggcttcccctcggtcgaaggcggcgtggacgcc
gcgatcgccatggtcgagggcggctgcgacatcgtggagatcggcctgccgcacagcgac
ccggtgctcgacgggccggtcatccagaccgccgacgacatcgcgctgcgcggcggggtg
aagatcgccgacgtactggagacggtacgccgggtgcacgccgccaccggcgcgccggtg
ctgtgcatgacgtactggaacccggtggaccggcacggcgccgagcggttcgccgaggaa
ctggccgccgccgggggcgccggctgcatcctgcccgacctgccggtggaggagtccgcg
cagtggcgggccgccgccgggcggcacgggctggccaccgtcttcgtcgtcgccccgagc
agccgggacgagcggctcgccgagatcaccgcggcgggcagcggcttcgtctacgcggcc
tcgctgatgggggtcaccggcacccgggcgtcggtgggcgcccaggccgccgacctggtg
cggcgcacccgggccacccccgccggccgccaggggctgccggtctgcgtgggcctgggg
gtctccaacggcgagcaggccgccgaggtggccgccttcgccgacggcgtcatcgtcggc
tccgccttcgtcaagcggctgctggactccgcggaccgcgagacgggcctggcgggcctg
cgggacctcgcgggcgagctggcggccggggtgcgcaagcgcggctga

DBGET integrated database retrieval system