KEGG   Streptomyces cattleya NRRL 8057: SCAT_1156Help
Entry
SCAT_1156         CDS       T01646                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCAT_1156 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCAT_1156 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCAT_1156 (trpA)
Enzymes [BR:sct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SCAT_1156 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1270814..1271641)
Genome map
AA seq 275 aa AA seqDB search
MSGNLGLLEKTLAAAKAEDRAALIGYLPAGFPSVEGGVDAAIAMVEGGCDIVEIGLPHSD
PVLDGPVIQTADDIALRGGVKIADVLETVRRVHAATGAPVLCMTYWNPVDRHGAERFAEE
LAAAGGAGCILPDLPVEESAQWRAAAGRHGLATVFVVAPSSRDERLAEITAAGSGFVYAA
SLMGVTGTRASVGAQAADLVRRTRATPAGRQGLPVCVGLGVSNGEQAAEVAAFADGVIVG
SAFVKRLLDSADRETGLAGLRDLAGELAAGVRKRG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcaacctcgggctgttggagaagacgctggccgccgccaaggcggaggaccgg
gccgcgctcatcggctacctgccggccggcttcccctcggtcgaaggcggcgtggacgcc
gcgatcgccatggtcgagggcggctgcgacatcgtggagatcggcctgccgcacagcgac
ccggtgctcgacgggccggtcatccagaccgccgacgacatcgcgctgcgcggcggggtg
aagatcgccgacgtactggagacggtacgccgggtgcacgccgccaccggcgcgccggtg
ctgtgcatgacgtactggaacccggtggaccggcacggcgccgagcggttcgccgaggaa
ctggccgccgccgggggcgccggctgcatcctgcccgacctgccggtggaggagtccgcg
cagtggcgggccgccgccgggcggcacgggctggccaccgtcttcgtcgtcgccccgagc
agccgggacgagcggctcgccgagatcaccgcggcgggcagcggcttcgtctacgcggcc
tcgctgatgggggtcaccggcacccgggcgtcggtgggcgcccaggccgccgacctggtg
cggcgcacccgggccacccccgccggccgccaggggctgccggtctgcgtgggcctgggg
gtctccaacggcgagcaggccgccgaggtggccgccttcgccgacggcgtcatcgtcggc
tccgccttcgtcaagcggctgctggactccgcggaccgcgagacgggcctggcgggcctg
cgggacctcgcgggcgagctggcggccggggtgcgcaagcgcggctga

DBGET integrated database retrieval system