KEGG   Streptomyces cattleya NRRL 8057: SCAT_1157Help
Entry
SCAT_1157         CDS       T01646                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCAT_1157 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCAT_1157 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCAT_1157 (trpB)
Enzymes [BR:sct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SCAT_1157 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1271638..1272876)
Genome map
AA seq 412 aa AA seqDB search
MSTDFFIPDTAGQVPSAAGYFGRFGGKFIPEALVAAVDEVAAEYEKAKADPAFAAELGDL
LVNYAGRPSALTEAARFAEHAGGARIFLKREDLNHTGSHKINNVLGQALLTRRMGKTRVI
AETGAGQHGVATATACALFGLECTIYMGEVDTERQALNVARMRMLGAEVVAVKSGSRTLK
DAINEAFRDWVANVDRTHYLFGTAAGPHPFPALVRDFHRVIGVEARRQLLERAGRLPDAV
LACVGGGSNAIGVFHAFLPDEGVRLIGLEAAGHGVDSGEHAATLTAGDPGILHGSRSYVL
QDEDGQITEPYSISAGLDYPGIGPEHSYLKDTGRAEYRPVTDDEAMQALRLLSRTEGIIP
AIESAHALAGALQAGRELGPDALLLVNLSGRGDKDMDTAARYFGLYPSEGAK
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgacttcttcatcccggacacggcgggccaggtgcccagcgccgccgggtac
ttcggccgcttcggcggcaagttcatccccgaggccctggtggccgcggtcgacgaggtc
gccgcggagtacgagaaggccaaggccgaccccgccttcgccgccgaactcggcgacctg
ctggtcaactacgccggccgccccagcgcgctgaccgaggccgcgcgcttcgccgagcac
gccggcggcgcccggatcttcctcaagcgcgaggacctcaaccacaccggctcccacaag
atcaacaacgtgctgggccaggccctgctcacccggcggatgggcaagacccgggtgatc
gccgagaccggcgccggacagcacggcgtggccaccgccaccgcctgcgccctgttcggc
ctggagtgcaccatctacatgggcgaggtcgacaccgagcgccaggcgctcaacgtcgcc
cggatgcgcatgctcggcgccgaggtggtcgccgtgaagtccggcagccgcaccctgaag
gacgccatcaacgaggcgttccgcgactgggtggccaacgtcgaccgcacccactacctg
ttcggcaccgcggccggcccgcaccccttcccggccctggtccgcgacttccaccgggtc
atcggcgtcgaggcccgccgccagctgctggagcgcgccgggcggctgccggacgccgtc
ctcgcctgcgtcggcggcggctccaacgccatcggggtcttccacgccttcctgcccgac
gagggcgtccggctgatcggcctggaggcggccggccacggcgtggactccggcgagcac
gcggccaccctcaccgccggcgaccccggcatcctgcacggctcgcgctcctacgtcctc
caggacgaggacggccagatcaccgagccgtactcgatctcggccggcctggactacccc
ggcatcggcccggagcactcgtacctgaaggacaccgggcgcgccgagtaccgcccggtc
accgacgacgaggcgatgcaggcgctgcggctgctgtcgcgcaccgagggcatcatcccg
gccatcgagagcgcccacgcgctcgccggcgccctccaggccggccgggaactcggcccc
gacgccctgctgctggtcaacctctccggccggggcgacaaggacatggacaccgccgcc
cgctacttcgggctctacccttcggaaggtgccaagtga

DBGET integrated database retrieval system