KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_1157Help
Entry
SCAT_1157         CDS       T01646                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase (beta subunit) (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCAT_1157 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCAT_1157 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCAT_1157 (trpB)
Enzymes [BR:sct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SCAT_1157 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1271638..1272876)
Genome map
AA seq 412 aa AA seqDB search
MSTDFFIPDTAGQVPSAAGYFGRFGGKFIPEALVAAVDEVAAEYEKAKADPAFAAELGDL
LVNYAGRPSALTEAARFAEHAGGARIFLKREDLNHTGSHKINNVLGQALLTRRMGKTRVI
AETGAGQHGVATATACALFGLECTIYMGEVDTERQALNVARMRMLGAEVVAVKSGSRTLK
DAINEAFRDWVANVDRTHYLFGTAAGPHPFPALVRDFHRVIGVEARRQLLERAGRLPDAV
LACVGGGSNAIGVFHAFLPDEGVRLIGLEAAGHGVDSGEHAATLTAGDPGILHGSRSYVL
QDEDGQITEPYSISAGLDYPGIGPEHSYLKDTGRAEYRPVTDDEAMQALRLLSRTEGIIP
AIESAHALAGALQAGRELGPDALLLVNLSGRGDKDMDTAARYFGLYPSEGAK
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgacttcttcatcccggacacggcgggccaggtgcccagcgccgccgggtac
ttcggccgcttcggcggcaagttcatccccgaggccctggtggccgcggtcgacgaggtc
gccgcggagtacgagaaggccaaggccgaccccgccttcgccgccgaactcggcgacctg
ctggtcaactacgccggccgccccagcgcgctgaccgaggccgcgcgcttcgccgagcac
gccggcggcgcccggatcttcctcaagcgcgaggacctcaaccacaccggctcccacaag
atcaacaacgtgctgggccaggccctgctcacccggcggatgggcaagacccgggtgatc
gccgagaccggcgccggacagcacggcgtggccaccgccaccgcctgcgccctgttcggc
ctggagtgcaccatctacatgggcgaggtcgacaccgagcgccaggcgctcaacgtcgcc
cggatgcgcatgctcggcgccgaggtggtcgccgtgaagtccggcagccgcaccctgaag
gacgccatcaacgaggcgttccgcgactgggtggccaacgtcgaccgcacccactacctg
ttcggcaccgcggccggcccgcaccccttcccggccctggtccgcgacttccaccgggtc
atcggcgtcgaggcccgccgccagctgctggagcgcgccgggcggctgccggacgccgtc
ctcgcctgcgtcggcggcggctccaacgccatcggggtcttccacgccttcctgcccgac
gagggcgtccggctgatcggcctggaggcggccggccacggcgtggactccggcgagcac
gcggccaccctcaccgccggcgaccccggcatcctgcacggctcgcgctcctacgtcctc
caggacgaggacggccagatcaccgagccgtactcgatctcggccggcctggactacccc
ggcatcggcccggagcactcgtacctgaaggacaccgggcgcgccgagtaccgcccggtc
accgacgacgaggcgatgcaggcgctgcggctgctgtcgcgcaccgagggcatcatcccg
gccatcgagagcgcccacgcgctcgccggcgccctccaggccggccgggaactcggcccc
gacgccctgctgctggtcaacctctccggccggggcgacaaggacatggacaccgccgcc
cgctacttcgggctctacccttcggaaggtgccaagtga

DBGET integrated database retrieval system