KEGG   Streptomyces cattleya NRRL 8057: SCAT_1206Help
Entry
SCAT_1206         CDS       T01646                                 

Gene name
murE
Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sct00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sct00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1321969..1323594)
Genome map
AA seq 541 aa AA seqDB search
MPHADQSTTLHRGGTPNAHDGPGKQPGPPRPSQVRPKPLAELAGQLGTAAPAGDALVTGI
THDSRAVRPGDIYAALPGARFHGADFTAQAAERGAVAVLTDPAGRDRAAATGLPVLTVAD
PRARMGALAAAVYDEPGRDLLQIGITGTSGKTTTAYLVEGGLRAVHGDDTGLIGTVESRI
GTERLKSERTTPEATDLQALFAAMRERGVRAVAMEVSSHALVLGRVDGAVFDVAVFTNLS
PEHMEFHSGMEDYFQAKAQLFTPARSRRGVVNHDDEYGRRLLAEATVPLVSFSAEGHPDA
DWRAEEVVVGTEGSTFTAVGPGGERIRAAAPLPGPFNVANALAALVALVTAGIDARTAAD
GIAAVTGVPGRLERVDAGQPFLAVVDYAHKTDAVESVLRALRKVTEGRVHIVLGCGGDRD
QHKRGPMGAACARLADTAVLTSDNPRSEDPLAILAAMLAGAAEVPAHERGHVTVEPDRAT
AIATAVARAEPGDTVLVAGKGHEQGQDIAGVVRPFDDREVLREAIEHASRRQPQPKDQDQ
Q
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
gtgccacatgctgatcagtccaccaccctgcaccgcgggggtacccccaacgcgcacgac
ggcccgggcaagcagccgggccctccgcgcccgtcccaggtccgccccaagccgctcgcg
gaactggccgggcagctcggcaccgcggcgccggccggggacgccctcgtcaccggcatc
acccacgactcgcgggcggtgcgccccggtgacatctacgcggccctgcccggcgcccgg
ttccacggcgccgacttcaccgcgcaggccgccgaacgcggggccgtcgccgtactgacc
gaccccgcggggcgcgaccgcgcggcggccaccgggctgccggtgctcaccgtcgccgat
ccgcgcgcccggatgggggcgctcgccgccgccgtctacgacgagcccggccgcgacctg
ctccagatcggcatcaccggcacctccggcaagaccaccaccgcctacctggtggaaggc
gggctgcgcgcggtccacggcgacgacaccgggctgatcggcaccgtcgagtcgcggatc
ggcaccgaacggctcaagagcgaacgcaccacgcccgaggccaccgacctccaggcgctc
ttcgccgccatgcgcgagcgcggggtgcgggcggtggccatggaggtctccagccacgcc
ctggtgctcggccgggtcgacggcgccgtcttcgacgtggccgtcttcaccaacctcagc
ccggagcacatggagttccactccggcatggaggactacttccaggccaaggcgcagttg
ttcaccccggcgcgcagccgccgcggcgtggtcaaccacgacgacgagtacggccgccgg
ctgctcgccgaggccaccgtgccgctggtgagcttctccgccgagggccacccggacgcc
gactggcgggccgaggaggtggtggtgggcaccgagggcagcaccttcaccgccgtcggc
cccgggggcgagcggatccgcgccgccgcgccgctgcccggcccgttcaacgtcgccaac
gcgctggccgccctggtcgccctggtcaccgccgggatcgacgcgcggaccgccgccgac
ggcatcgccgcggtgaccggcgtccccggccgcctcgaacgggtcgacgccggacagccg
ttcctggccgtggtggactacgcgcacaagaccgacgccgtcgaatcggtgctgcgcgcg
ctgcgcaaggtcaccgagggccgcgtccacatcgtgctcggctgcggcggcgaccgcgac
cagcacaagcgcggaccgatgggcgccgcctgcgcccggctcgcggacaccgccgtactc
acctcggacaacccccgttccgaggacccgctggcgatcctggccgccatgctcgccggt
gccgccgaggtaccggcccatgaacgcggccatgtcaccgtggagcccgaccgggccacc
gcgatcgccaccgccgtggcccgcgccgagccgggcgacaccgtgctcgtcgcgggcaag
ggccatgagcagggccaggacatcgccggagtggtacgccccttcgacgaccgggaggtg
ctgcgcgaggcgatcgagcacgcctcgcgtcggcagccgcagccaaaggaccaggaccag
cagtga

DBGET integrated database retrieval system