KEGG   Streptomyces cattleya NRRL 8057: SCAT_1247Help
Entry
SCAT_1247         CDS       T01646                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCAT_1247 (pfkA)
   01230 Biosynthesis of amino acids
    SCAT_1247 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAT_1247 (pfkA)
   00030 Pentose phosphate pathway
    SCAT_1247 (pfkA)
   00051 Fructose and mannose metabolism
    SCAT_1247 (pfkA)
   00052 Galactose metabolism
    SCAT_1247 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SCAT_1247 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SCAT_1247 (pfkA)
Enzymes [BR:sct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SCAT_1247 (pfkA)
Protein phosphatases and associated proteins [BR:sct01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SCAT_1247 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1362456..1363487)
Genome map
AA seq 343 aa AA seqDB search
MRVGVLTGGGDCPGLNAVIRAMVRKGVQNHGFEFTGFRDGWRGPLEGLTRQLDIPAVRGI
LPRGGTILGSSRTNPLKAENGVRRVKENLAKYEVDALVAIGGEDTLGVAARLYDEYGVPC
VGVPKTIDNDLSATDYTFGFDTAVNIATEAIDRLHTTAESHMRVLVVEVMGRHAGWIALH
AGLAGGANVILLPEQRFDLDQVCGWVESRFQASYAPIVVVAEGAMPKDGDLVVKDADQLD
SFGHVRLSGIGDWLAKEIEKRTGKEARTTVLGHIQRGGTPTAFDRWLATRFGLHAIDAVR
DREFGTMVALRGTDIVRVPLTEATAKLKTVDPALYAEAGVFFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcggagtgctgaccggcggcggcgactgccccggtctcaacgccgtgatccgg
gccatggtccgcaagggcgtacagaaccacgggttcgagttcacgggcttccgcgacggc
tggcgcggcccgctcgaagggctcaccaggcaactggacatccccgcggtccgcggcatc
ctgccccgcggcggcaccatcctcggctcctcccgcaccaaccccctcaaggccgagaac
ggggtccgccgggtcaaggagaacctcgccaagtacgaggtggacgccctcgtcgcgatc
ggcggcgaggacaccctgggggtggccgcccggctgtacgacgagtacggcgtcccctgc
gtcggcgtacccaagaccatcgacaacgacctgagcgccaccgactacaccttcggcttc
gacaccgcggtcaacatcgccaccgaggccatcgaccggctgcacaccaccgccgagtcc
cacatgcgggtgctggtggtggaggtgatgggccggcacgccggatggatcgcgctgcac
gccgggctcgcgggcggcgccaacgtcatcctcctgcccgagcagcgcttcgacctcgac
caggtctgcggctgggtggagtcccgtttccaggccagctacgcgccgatcgtggtggtc
gccgagggcgccatgcccaaggacggcgacctggtggtcaaggacgccgaccagctcgac
tccttcggccacgtacgcctctccggcatcggcgactggctcgccaaggagatcgagaag
cgcaccggcaaggaggcccgcaccaccgtgctcggccacatccagcgcggcggcaccccc
accgccttcgaccgctggctcgccacccgcttcggcctgcacgccatcgacgcggtacgg
gaccgggagttcggcaccatggtcgcgctgcgcggcaccgacatcgtccgggtaccgctc
accgaggccaccgccaagctcaagacggtcgacccggcgctctacgccgaggcgggcgtc
ttcttcggctga

DBGET integrated database retrieval system