KEGG   Streptomyces cattleya NRRL 8057: SCAT_1251Help
Entry
SCAT_1251         CDS       T01646                                 

Definition
Thermostable monoacylglycerol lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sct  Streptomyces cattleya NRRL 8057
Brite
Enzymes [BR:sct01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SCAT_1251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1366578..1367372
Genome map
AA seq 264 aa AA seqDB search
MPLLPGAEPYRHDGGEVGVLLCHGFTGSPQSMRPWGEYLADRGLSVSVPLLPGHGTRWQD
MQITGWQDWYAEVERELLALRDRCRRVFVFGLSMGGSLTLRLAARHPSEVSGIALVNPAV
RAYGAAFKAVPVLRHLMPSVAGIASDIAKDGQAEVGYDRTPLHAVYAMTRLWRLVEADLP
RVTAPLLLMTSRVDHVVDPANSDVVAAGVGSTDITRRTLDRSYHVATLDHDAEEIFRTSY
AFVRRLEPEAAPATEGTADEVAGG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgccgctgcttcctggtgccgagccgtaccgccacgacggcggcgaggtcggagtgctg
ttgtgccacggattcaccggctcccctcagtcgatgcgcccctggggcgagtatctcgcc
gaccgcgggctctccgtctccgtaccgctgcttcccggccacggcacccgctggcaggac
atgcagatcaccggctggcaggactggtacgcggaggtggaacgggagctgctcgcgctg
cgggaccgctgccgccgggtcttcgtcttcgggctgtccatgggcggctccctcaccctg
cggctggccgcccggcacccgtccgaggtcagcggcatcgccctggtgaacccggctgtg
cgggcgtacggcgccgcgttcaaggcggttccggtgctgcggcatctgatgccgtcggtg
gccgggatcgccagcgacatcgccaaggacggtcaggccgaggtggggtacgaccgcacg
ccgctgcacgccgtgtacgcgatgaccaggctgtggcggctggtggaggccgatctgccg
cgggtgacggcgccgctgctgctgatgaccagccgggtcgaccacgtggtggacccggcc
aactccgacgtcgtggcggccggcgtcggcagcaccgacatcacccggcgcaccctggac
cgcagctaccacgtggccaccctcgaccacgacgcggaggagatcttccgcacctcgtac
gcgttcgtgcggcggctggagccggaggcggcaccggccacggagggtacggcggacgag
gtggccggtggctga

DBGET integrated database retrieval system