KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_1254Help
Entry
SCAT_1254         CDS       T01646                                 

Gene name
glkA
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct00010  Glycolysis / Gluconeogenesis
sct00052  Galactose metabolism
sct00500  Starch and sucrose metabolism
sct00520  Amino sugar and nucleotide sugar metabolism
sct00521  Streptomycin biosynthesis
sct01100  Metabolic pathways
sct01110  Biosynthesis of secondary metabolites
sct01120  Microbial metabolism in diverse environments
sct01130  Biosynthesis of antibiotics
sct01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAT_1254 (glkA)
   00052 Galactose metabolism
    SCAT_1254 (glkA)
   00500 Starch and sucrose metabolism
    SCAT_1254 (glkA)
   00520 Amino sugar and nucleotide sugar metabolism
    SCAT_1254 (glkA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SCAT_1254 (glkA)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SCAT_1254 (glkA)
Enzymes [BR:sct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SCAT_1254 (glkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase Hydant_A_N BcrAD_BadFG FGGY_N DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: CCB73974
UniProt: F8K0W0
Position
complement(1369229..1370170)
Genome map
AA seq 313 aa AA seqDB search
MGLTIGVDIGGTKIAAGVVDEEGTILDTCKVPTPPTPEGVIDAIADAVRTVSTDHQVEAV
GIGAAGYVDNKRATVLFAPNINWRHETLKDKVEQRVGLPVVVENDANAAAWGEYRFGAGQ
GHDDVVCITLGTGLGGGIIIGGRLHRGRFGVAGEFGHIRVVPDGLLCGCGSQGCWEQYAS
GRALVRYARQRAAATPDAAKILLGLGDGTPETIEGKHISEAARQGDPVAVDSFRELARWA
GAGLADLASLFDPSAFIVGGGVSDEGDLVLDPIRKSFRRWLVGGRWRPHAQVLAAQLGGK
AGLVGAADLARQG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgggactcaccatcggcgtcgacatcggcggtaccaagatcgcggccggtgtggtcgac
gaagagggcacgattctcgacacctgcaaggtgccgaccccgccgacgcccgagggcgtc
atcgacgccatcgccgacgcggtgcgcaccgtgagcaccgaccaccaggtcgaggcggtc
ggcatcggcgccgccggatacgtcgacaacaagcgcgccaccgtgctcttcgcgcccaac
atcaactggcgccacgagacgctcaaggacaaggtcgagcagcgcgtcggcctccccgtg
gtggtggagaacgacgccaacgccgccgcctggggcgaataccgcttcggcgccggccag
ggccacgacgacgtcgtctgcatcaccctgggcaccggactcggcggcggcatcatcatc
ggcggccggctccaccgcggccggttcggcgtggccggcgagttcggccacatccgggtg
gtcccggacggcctgctgtgcggctgcggcagccagggctgctgggagcagtacgcctcc
gggcgcgccctggtgcggtacgcccggcagcgcgcggcggccaccccggacgccgccaag
atcctgctgggcctgggtgacggcaccccggagaccatcgagggcaagcacatcagcgag
gccgcccggcagggcgacccggtggccgtcgactccttccgggagctggcccgttgggcc
ggcgcgggcctggccgacctcgcctcgctcttcgacccgtccgcgttcatcgtgggcggc
ggcgtctccgacgagggcgacctggtgctcgacccgatccgcaagtcgttccgccgctgg
ctggtcggcggccggtggcgtccgcacgcccaggtgctcgccgcccagctcggcggcaag
gcgggcctggtgggcgccgccgacctcgcccgtcagggctga

DBGET integrated database retrieval system