KEGG   Streptomyces cattleya NRRL 8057: SCAT_1304Help
Entry
SCAT_1304         CDS       T01646                                 

Gene name
sucB
Definition
Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCAT_1304 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCAT_1304 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SCAT_1304 (sucB)
Enzymes [BR:sct01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SCAT_1304 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1419896..1421650
Genome map
AA seq 584 aa AA seqDB search
MAVSVTLPALGESVSEGTVTRWLKAEGERVEADEPLLEVSTDKVDTEIPAPASGVLTSIK
VAEDETVEVGAELAVIDDGSGAPAEAPAPAAAAAEEPAPQAPAAPAPAPQAEAPAPAPAE
QAPAAPAGGAEGTDVVLPALGESVTEGTVTRWLKQVGEDVEADEPLLEVSTDKVDTEIPA
PVSGTLLEIVVGEDETAEVGAKLAVIGAKGAAPAAAPAPAAPAPAPAQEAPAPAPAPAPA
APAQEAPAPQPAAPAPAPAPAPAAPAPAAVTPAAVAEGEGPYVTPLVRKLAAENNVNLAA
VKGTGVGGRIRKQDVLAAAEAAKAAAPAPSAAPAAAATVPAAAAALRGQTVKMSRIRKVI
ADNMMKALHSQAQLSTVVEVDVTRIMKLRARAKESFLAREGVKLSPMPFFVKAAAEALKA
HPSINAKINDDGTVTYHDVENIGIAVDSEKGLMVPVIKGAGDLNIAGIAKKTAELAGRVR
SGKLSPDDMSGGTFTISNTGSRGALFDTIIVNYPQVAELGIGATVRRPVVIDHPELGETI
AIRDMVYLTLSYDHQLVDGADAARYLTDVKARLEAGEFEGDLGL
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggcggtttccgtaaccctgccggcgctcggcgagagcgtgtccgagggcaccgtcacc
cgctggctgaaggccgagggtgagcgcgtggaggccgacgagccgctgctcgaggtctcc
accgacaaggtcgacaccgagatcccggccccggcgtccggcgtcctcacctccatcaag
gtggccgaggacgagacggtggaggtcggcgccgagctggccgtcatcgacgacggctcg
ggggccccggccgaggcgcccgccccggccgccgccgctgccgaggagcccgccccgcag
gctccggccgccccggctccggccccgcaggccgaggccccggcgcccgcgccggccgag
caggccccggccgccccggccggtggcgccgagggcaccgacgtcgtcctgcccgcgctg
ggcgagtcggtcaccgagggcaccgtcacccgctggctgaagcaggtcggcgaggacgtc
gaggccgacgagccgctgctggaggtctccaccgacaaggtggacaccgagatcccggcg
ccggtctccggcaccctgctggagatcgtggtcggcgaggacgagaccgccgaggtcggc
gcgaagctcgccgtcatcggtgccaagggcgccgctccggccgccgccccggctccggcc
gcgcccgccccggccccggcgcaggaagccccggcccccgcgccggctccggctccggcc
gccccggcgcaggaggcccccgccccgcagcccgccgccccggcgcccgcgcccgccccg
gctccggccgcgcccgccccggccgccgtcaccccggccgcggtcgccgagggcgagggt
ccgtacgtgaccccgctggtccgcaagctcgccgcggagaacaacgtcaacctggccgcg
gtcaagggcaccggtgtcggtggccgcatccgcaagcaggacgtgctcgccgccgccgag
gccgccaaggccgccgccccggcgccgtccgccgctccggccgccgccgccacggtcccg
gccgccgccgcggcgctgcgcggtcagaccgtcaagatgtcgcgcatccgcaaggtcatc
gccgacaacatgatgaaggcgctgcacagccaggcgcagctgtccaccgtggtcgaggtg
gacgtcacccggatcatgaagctgcgcgcccgggccaaggagtccttcctggcccgtgag
ggcgtcaagctctcgccgatgccgttcttcgtcaaggccgccgccgaggcgctcaaggcc
cacccgtcgatcaacgccaagatcaacgacgacggcacggtcacctaccacgacgtcgag
aacatcggcatcgcggtggactcggagaagggcctgatggtcccggtcatcaagggcgcg
ggcgacctgaacatcgccggcatcgccaagaagaccgccgagctggccggcagggtccgc
agcggcaagctgagcccggacgacatgtccggcggcacgttcacgatcagcaacaccggc
tcgcgcggtgcgctcttcgacacgatcatcgtgaactacccgcaggtcgccgagttgggc
atcggtgccaccgtgcgccgtccggtggtcatcgaccacccggagctgggtgagaccatc
gccatccgcgacatggtctacctgaccctctcctacgaccaccagctggtcgacggtgcc
gacgcggcccgttacctgacggacgtcaaggcccgtctggaggccggcgagttcgagggc
gacctcgggctgtag

DBGET integrated database retrieval system