KEGG   Streptomyces cattleya NRRL 8057: SCAT_1631Help
Entry
SCAT_1631         CDS       T01646                                 

Gene name
proB
Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCAT_1631 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SCAT_1631 (proB)
Enzymes [BR:sct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SCAT_1631 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1761370..1762515)
Genome map
AA seq 381 aa AA seqDB search
MTVDGRRQGGDVRHEVTAARRIVVKIGSSSLTTAVGGLATDRMDALVEVLAGARDGAKEI
VLVSSGAIAAGLAPLGLERRPRDLARQQAAASVGQGLLVAGYTAAFARHGIRVGQVLLTA
DDVSRRAHYRNAYRTFEQLLAMGALPVVNENDTVATDEIRFGDNDRLAALVAHLVRADLL
VLLSDVDGVYDGDPSRPGSRRIPEVAGPGDLAGVEIGSAGKAGVGTGGMVTKVQAARIAA
DAGIPVVLTSAAEAADALAGRPTGTFFHATGKRSAVRLLWLEHASEPRGALRLDAGAVRA
VVERRTSLLPAGLTGVEGQFSAGDPVDLLDEEGRAVARGLVNFDAEELPRLLGRSTRELA
AEFGPEYEREVVHRDDLVVLH
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgacagtggacggccggcgacagggcggggacgtacggcacgaggtgacggcggcgcgc
cggatcgtcgtcaagatcggctcctcctcactgaccaccgccgtcggcgggctggccacc
gaccggatggacgccctggtggaggtgctcgccggggcgcgggacggcgccaaggagatc
gtgctggtctcctccggcgcgatcgccgccgggctggccccgctcggcctggagcgccgc
ccgcgtgacctggcccggcagcaggccgccgccagcgtcggccaggggctgctggtggcc
gggtacaccgcggccttcgcccgccacggcatccgggtcgggcaggtgctgctcaccgcc
gacgacgtcagccgccgggcccactaccgcaacgcctaccgcaccttcgagcagctgctg
gccatgggcgcgctgccggtggtcaacgagaacgacacggtggccaccgacgagatccgg
ttcggtgacaacgaccggctcgccgccctcgtcgcccacctggtccgggccgatctgctg
gtgctcctctccgacgtggacggggtctacgacggcgacccgagccgcccgggcagccgg
cgcatccccgaggtggccggccccggcgacctcgccggggtggagatcggcagcgccggc
aaggcgggcgtgggcaccggcggcatggtgaccaaggtgcaggcggcccggatcgccgcc
gacgccgggatcccggtggtgctgacctccgccgccgaggccgccgacgccctggccggc
cgccccaccggcaccttcttccacgccaccggcaagcgctcggcggtccggctgctgtgg
ctggagcacgcctccgaaccgcgcggcgcgctgcgcctggacgcgggcgcggtacgggcg
gtggtggagcggcgcacctcgctgctgccggccgggctcaccggggtcgagggccagttc
tccgccggcgacccggtcgacctgctggacgaggagggccgggcggtcgcccgcgggctg
gtcaacttcgacgccgaggagctgccccggctgctcggccgctccacccgcgagctggcc
gccgagttcggcccggagtacgaacgcgaggtcgtccaccgcgacgacctggtggtgctg
cactga

DBGET integrated database retrieval system