KEGG   Streptomyces cattleya NRRL 8057: SCAT_1759Help
Entry
SCAT_1759         CDS       T01646                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sct00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1864609..1866723)
Genome map
AA seq 704 aa AA seqDB search
MGRADGAAPAPPRTRAPLPDALARLAALHGVQTSYQPAPGRTVHVPEATVVAVLAALGVD
AAGPGAVRDALDRHERLARTRLLPPCVVVRDGAPLRLEVPPGTELTVVPEGGSGAARPAT
GDGALPLGHHLLRARTPDGRTAAAPLIVVPGRLPGPAGRAYGLMVQLYSLLSARSWGMGD
LGDLAELAGWAGRALGAGFLTVNPLHSAVPGDPTDPSPYRPSSRRFPDPVYLRVEEVPEY
AYLEPAARARVDGLLARAAELRAAVLDEGALIDRDAVWRLKSAALEIVREVPLAPGRRAA
YCDFLAEAGQALDDHATWCALAELHGSDWHTWPAALRDPRSAQTARARGERLDRVDFHCW
LAWLTDTQLAAASAAAARAGMSVGIVHDLAVGVHPSGADAWALGDVLARGMSVGAPPDLF
NPRGQDWSLPPWRPDALAATGYAPYRDLLRGVLRHAGGLRVDHVMGLSRLWWVPEGRPPT
EGTYVRYDAGAMLGVLALEAHRAGAVVIGEDLGTVEPGMRESLADHGILGTSVLWFERDH
TGDGRPLPPDRWRADCLATVTTHDLPSTAARLTGEHVALRHRLGLLTRPLADEQGQDTAE
VAEWLALLGRLGLLPEGAHDEEGAVRAVHRFLLRTPARLIGVWLPDTVGDRRPQNLPGTR
DEYPNWRLPVADHRGRPVTLERLAGDARVHALAELLRQGVAGAG
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgggccgagccgacggggccgcccccgcaccgccccgcacccgggccccgctgcccgac
gcactcgcccggctggccgccctgcacggggtccagacctcgtaccagcccgcgcccggc
cgcaccgtgcacgtccccgaggccaccgtggtcgccgtgctcgccgcgctcggtgtggac
gccgccggccccggcgcggtgcgcgacgcgctcgaccgccacgagcggttggcgcgcacc
cggctgctgccgccgtgcgtggtggtacgcgacggtgcgccgctgcgcctggaggtgccg
ccgggcaccgagctgacggtggtgcccgaaggcggatccggcgcggcgcgtccggccacc
ggcgacggcgcgctccccctcggccaccacctgctgcgcgcccgcaccccggacgggcgt
accgccgccgccccgctgatcgtcgtccccggccggctgcccggccccgccggacgcgcc
tacgggctgatggtgcagctctactcgctgctgtcggcccgctcctggggcatgggcgac
ctcggcgacctcgcggagctggccgggtgggcgggacgggcgctcggcgccggtttcctc
accgtcaacccgctgcactccgccgtccccggcgaccccaccgacccctccccgtaccgg
ccctcctcgcgccgcttcccggacccggtctacctgcgggtggaggaggtccccgagtac
gcctacctggagccggccgcccgggcgcgggtcgacgggctgctcgcccgcgccgccgaa
ctgcgcgcggcggtgctcgacgagggggcgctcatcgaccgggacgcggtgtggcggctg
aagagcgcggccctggagatcgtccgcgaggtgccgctcgcccccggccgccgcgccgcc
tactgcgacttcctcgccgaggccggccaggccctcgacgaccacgccacctggtgcgcg
ctggccgaactccacggctccgactggcatacctggcccgccgcgctgcgcgacccgcgc
tccgcgcagaccgcccgcgcccgcggcgaacgcctggaccgggtggacttccactgctgg
ctcgcctggctgaccgacacccagctcgccgcggcctccgccgccgccgcgcgggccggc
atgtccgtgggcatcgtgcacgacctggcggtcggggtgcacccctcgggggccgacgcg
tgggcgctcggcgacgtcctcgcccgggggatgtccgtcggcgccccgccggacctgttc
aacccccgcggccaggactggagtctgccgccgtggcgcccggacgccctcgccgccacc
ggctacgccccctaccgcgatctgctgcgcggggtgctgcggcacgccgggggcctgcgc
gtcgaccacgtcatggggctctcccggctgtggtgggtgcccgagggacgtccgcccacc
gagggaacctacgtgcgctacgacgccggcgccatgctcggcgtcctcgcgctggaggcg
caccgggccggcgccgtggtgatcggcgaggacctgggcaccgtggagccggggatgcgg
gagagcctggccgaccacggaatcctgggcacctcggtgctgtggttcgaacgcgaccac
accggcgacggccgcccgctgcccccggaccgctggcgcgccgactgcctggccaccgtc
accacccacgacctgcccagcaccgcggcccggctcaccggcgaacacgtggccctgcgc
caccggctcggcctgctcacccgtccgctcgccgacgagcagggccaggacaccgccgag
gtcgccgaatggctggcgctgctcggccggctcggcctgctgccggagggcgcccacgac
gaggagggcgccgtccgggccgtccaccgcttcctgctgcgcaccccggcccggctgatc
ggcgtgtggctgccggacacggtcggcgaccggcgcccgcagaacctgcccggcacccgg
gacgagtaccccaactggcggctgcccgtcgccgaccaccggggccgcccggtcaccctg
gaacggctggccggtgacgcccgggtgcacgccctcgccgagctgctgcggcagggggtg
gccggcgccggatga

DBGET integrated database retrieval system