KEGG   Streptomyces cattleya NRRL 8057: SCAT_1838Help
Entry
SCAT_1838         CDS       T01646                                 

Definition
exodeoxyribonuclease V
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sct03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1940341..1942629)
Genome map
AA seq 762 aa AA seqDB search
MDPRPPSQPRPQPGKQPQRPPGQGEFRPAVLEAVLERITYANKENGYTVARVDTGRGSGD
LLTVVGALLGAQPGESLRMEGRWGSHPQYGKQFTVENYTTVLPATIQGIRRYLGSGLIKG
VGPRIAERIVSHFGTDTLEVIEQDPARLIEVPGLGPKRTRKIAAAWEEQKAIKEVMVFLQ
GVGVSTSIAVRIYKQYGDASISVVRNEPYRLAADVWGIGFLTADRIAQAVGIPHDSPERV
KAGLQYALSQATDNGNCFLPEERLIADAVKLLQVDTGLVIDCLGELVEAEGVVRERVPDP
DGGDAIRAVYLVPFHRAEISLAGQVLRLLRGPEDRMPAFRDVAWDKALAWLRDRTGAELA
PEQEQAVRLALTEKVAVLTGGPGCGKSFTVKSVVTLARAKKAKVVLAAPTGRAAKRLAEL
TGAEASTVHRLLELKPGGDAAYDRDRPLDADLVVVDEASMLDLILANKLVKAVPPGAHLL
FVGDVDQLPSVGAGEVLRDLLAEGSPVPAVRLTRIFRQAQQSGVVTNAHRINSGLPPVTQ
GLADFFLFPEEDTEEAGRLTVDVVARRIPAKFGLDPRRDVQVLAPMHRGPAGAGVLNGLL
QQAVTPGRPDLPERRFGGRVFRVGDKVTQIRNNYDKGANGVFNGTVGVVTALDNDEHRLT
VRTDEDEEVGYDFDELDELAHAYAVTIHRSQGSEYPAVVIPVTTGAWMMLQRNLLYTAVT
RAKRLVVLVGSRRALAQAVRTVSAGRRFTALDHRLRGAVRES
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggatccgcgaccgccgtcacaaccccgcccgcagccggggaagcagccgcaacggccc
ccgggccagggcgagttccgccccgccgtcctggaggccgtgctggaacgcatcacgtac
gccaacaaggagaacggctacacggtggcccgcgtcgacaccggccgcggctcgggcgac
ctgctcaccgtcgtcggcgccctgctcggcgcgcagcccggcgaatccctgcgcatggag
ggccgctggggctcccacccgcagtacggcaagcagttcaccgtggagaactacaccacc
gtcctgcccgccaccatccagggcatccgccgctacctgggctccgggctgatcaagggg
gtcggcccgcgcatcgccgagcgcatcgtctcccacttcggcaccgacaccctggaggtg
atcgagcaggacccggcccgcctcatcgaggtccccggcctcggccccaaacgcaccagg
aagatcgccgccgcctgggaggagcagaaggcgatcaaggaagtgatggtcttcctccag
ggcgtgggcgtctccacctcgatcgcggtgcgcatctacaagcagtacggcgacgcctcg
atctccgtggtgcgcaacgagccctaccgcctcgccgccgacgtgtggggcatcggcttc
ctcaccgccgaccgcatcgcccaggccgtcggcataccgcacgacagcccggagcgggtc
aaggccgggctccagtacgcgctctcccaggccaccgacaacggcaactgcttcctgccc
gaggaacgcctcatcgccgacgccgtcaaactcctccaggtcgacaccgggctggtcatc
gactgcctgggggagctggtcgaggccgagggggtggtccgggagcgggtgccggatccg
gacggcggtgacgcgatccgcgcggtctacctggtgcccttccaccgcgccgagatatcg
ctggccggccaggtgctgcggctgctgcgcggcccggaggaccggatgcccgccttccgc
gacgtggcctgggacaaggcgctggcctggctgcgcgaccggaccggcgccgagctcgcc
ccggagcaggagcaggcggtgcggctggcgctcaccgagaaggtcgcggtgctcaccggc
ggccccggctgcggcaagtcgttcaccgtgaaatcggtggtgaccctggcccgggccaag
aaggccaaggtggtgctggccgccccgaccgggcgggccgccaagcggctggccgagctg
accggggcggaggcgtccaccgtccaccggctgctggagctcaagcccggcggtgacgcc
gcctacgaccgcgaccgcccgctcgacgccgacctggtcgtggtcgacgaggcgtccatg
ctcgacctgatcctcgccaacaagctggtcaaggcggtgccgccgggggcccacctgctc
ttcgtgggcgatgtcgaccagctgccgagcgtgggcgcgggagaggtgctgcgcgacctg
ctggccgagggcagtccggtgcccgcggtgcggctcacccggatcttccgccaggcccag
cagtccggggtggtcaccaacgcccaccggatcaactccgggctgccgccggtcacccag
gggctcgccgacttcttcctcttccccgaggaggacaccgaggaggccgggcggctcacg
gtggacgtggtggcgcggcgcatcccggccaagttcggcctcgacccgcgccgcgacgtc
caggtgctcgccccgatgcaccgcggaccggccggcgccggggtgctcaacgggctcctc
cagcaggcggtcacccccggccgccccgacctgcccgagcgccgcttcggcggccgggtc
ttccgggtcggcgacaaggtcacccagatccgcaacaactacgacaaaggcgccaacggt
gtcttcaacggcacggtcggcgtggtcaccgcgctcgacaacgacgaacaccggctcacc
gtgcgcaccgacgaggacgaggaggtcggctacgacttcgacgaactggacgaactggca
catgcctacgcggtgaccatccaccgttcccagggcagcgagtatcccgccgtggtgatc
ccggtcaccacgggcgcctggatgatgctccagcgcaatctgctctatacggccgtgacc
cgggcaaagcggttggtggttctggtcggctcacggcgggcactcgcacaggcggtacgc
accgtttccgcaggccgacgcttcaccgcactcgatcaccggctgcgcggcgcggtgcgg
gagagctga

DBGET integrated database retrieval system