KEGG   Streptomyces cattleya NRRL 8057: SCAT_1839Help
Entry
SCAT_1839         CDS       T01646                                 

Gene name
rbsK
Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCAT_1839 (rbsK)
Enzymes [BR:sct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SCAT_1839 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1942853..1943776
Genome map
AA seq 307 aa AA seqDB search
MRDGEDGYDLVVVGSANADLVVRVERRPAPGETVIGTGPATHPGGKGANQAVAAARLGAR
TALLARVGDDDHGRLLLDTQRSAGVDTGGVLVGGAPTGVALVAVDPSGDRGVVLVPGANA
RLTPHDVAAAGALLAAARVVAVQLEIPLETVAAAVREAVRARTRVVLNASPPARLPAEVL
AACDPLLVDGDEARALLRDAGDPAADSAAPKTWAEALAARGPRSVVITLGASGALAAGPD
GIVHVPGRTVEAVDTTGAGDAFAGALAWRLAAGDGLAEAVRLAVRAGAAAVTRPGAQAAF
PTARELP
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcgggacggcgaggacggttacgacctggtggtcgtggggtcggccaacgccgacctg
gtggtacgggtggagcgccgcccggcgcccggcgagaccgtgatcggcaccggcccggcc
acccaccccggcggcaagggcgccaaccaggcggtggccgccgcccggctcggcgcccgc
acggcgctgctggcccgggtcggcgacgacgaccacggacggctgctgctggacacccag
cgttcggcgggcgtggacaccggcggcgtcctggtcggcggcgcccccaccggggtcgcg
ctggtcgccgtcgatccctccggtgaccgcggcgtcgtgctggtccccggcgccaacgcc
cggctcaccccgcacgacgtcgccgcggccggcgcgctgctggccgccgcccgggtggtc
gccgtgcagctggagataccgctggagacggtggccgcggcggtccgggaggcggtacgg
gcccgtacccgggtggtgctcaacgcctcgccgccggcccggctgcccgccgaggtgctg
gccgcctgcgatccgctgctggtcgacggggacgaggcgcgcgccctgctgcgcgacgcc
ggcgaccccgccgcggactcggcggcgccgaagacgtgggccgaggcgctcgccgcgcgc
ggcccgcgctcggtggtgatcaccctgggcgcctcgggggcgctggcggcggggccggac
ggcatcgtccacgtgcccgggcgcaccgtcgaggccgtggacaccaccggcgccggggac
gccttcgccggcgccctggcctggcggctggcggccggggacggcctcgcggaggcggtg
cgcctggcggtgcgggcgggcgccgccgccgtcacccggcccggcgcgcaggccgcgttc
cccaccgcgcgtgagctgccgtga

DBGET integrated database retrieval system