KEGG   Streptomyces cattleya NRRL 8057: SCAT_1848Help
Entry
SCAT_1848         CDS       T01646                                 

Gene name
gbh
Definition
Guanidinobutyrase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SCAT_1848 (gbh)
Enzymes [BR:sct01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SCAT_1848 (gbh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1956680..1957651)
Genome map
AA seq 323 aa AA seqDB search
MTTSEPRGPIDSSRVPRFAGPATFARLPRLDEVGTTDVAVVGVPFDAGVSYRPGARFGGN
AIREASRLLRPYNPAQDASPFALAQVADAGDIAANPFNINEAVETIQAAADDLLDTGARL
MTLGGDHTIALPLLRSVARRHGPVALLHFDAHLDTWDTYFGAEYTHGTPFRRAVEEGILD
TSALSHVGTRGPLYGKRDLDDDAKMGFGIVTSADVMRRGVDEVAQQLRERIGDRPLYISI
DIDVLDPAHAPGTGTPEAGGMTSRELLEILRGLAGCNLVSADVVEVAPAYDHAEITSVAA
SHTAYELTTLMARQIAAARGTGA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccagcgagccgcgcggtccgatcgactcctcccgcgtcccccgtttcgccggc
ccggccaccttcgcccggctgccccggctggacgaggtcggcaccaccgacgtcgccgtg
gtgggcgtgccgttcgacgccggggtctcctaccgccccggcgcccgcttcggcggcaac
gccatccgtgaggcctcccgcctgctgcgcccgtacaacccggcgcaggacgcctccccg
ttcgcgctggcccaggtcgccgacgccggggacatagcggccaacccgttcaacatcaac
gaggcggtcgagaccatccaggccgccgccgacgacctgctcgacaccggcgcccggctg
atgacgctcggcggcgaccacaccatcgcgctgcccctgctgcgttccgtcgcccgcagg
cacggccccgtcgcgctgctccacttcgacgcccacctggacacctgggacacctacttc
ggcgccgagtacacccacggcaccccgttccgccgcgccgtcgaggagggcatcctcgac
acctccgccctctcccacgtcggcacccgcggcccgctctacggcaagcgggacctggac
gacgacgccaagatgggcttcggcatcgtcacctccgccgacgtcatgcggcgcggcgtg
gacgaggtcgcccagcaactgcgcgagcgcatcggcgaccgcccgctgtacatctccatc
gacatcgacgtgctcgacccggcgcacgccccgggcaccggcacccccgaggccggcggc
atgacctcgcgcgaactgctggagatcctgcgcggcctggccggctgcaacctggtctcc
gccgacgtcgtcgaggtggccccggcctacgaccacgcggagatcacctccgtcgccgcc
tcgcacaccgcctacgagctgaccaccctcatggcgcggcagatcgccgccgcccgggga
accggcgcctga

DBGET integrated database retrieval system