KEGG   Streptomyces cattleya NRRL 8057: SCAT_1903Help
Entry
SCAT_1903         CDS       T01646                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sct00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2014215..2015225)
Genome map
AA seq 336 aa AA seqDB search
MSAHPARPGALAAALVGVALLVAGCSSPGRAPRTETSHAAPALPGAPFWADPDSAAVQQR
EQWRADGHDADAALLDRIARQPAGKWIGGDDPEGQAARYTRQAAAAGRRALLVAYDIPHR
DCGQFSGGGAPDGTAYRSWVDRLAAGIGPRPATVVLEPDAVAHMVDGCTPPRYQDERYAL
LAYAVGRLTSLPATAVYLDAGNSGWITDPLRMAGPLRRAGVDRAAGFALNTSNFQTTRAS
TAYGLRLSEALGGKHFVIDTSRNGNGPLAGRDPQQGWCNPPGRALGTPPTTRTGRKLLDA
YLWVKPPGESDGPCNGGPPAGQWWPEYALDLARNAR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcacacccggcccgtcccggcgcgctcgccgccgcgctggtgggcgtcgcgctg
ctggtggccgggtgctcctcgcccggccgggcgccgcgtaccgagacctcccacgccgcc
cccgcgctccccggcgccccgttctgggccgacccggacagcgccgccgtccagcagcgc
gagcagtggcgcgcggacggccacgacgccgacgcggcgctgctcgaccggatcgcccgc
cagccggccggaaagtggatcggcggcgacgaccccgaggggcaggccgcccgctacacc
cggcaggccgcagccgccggccgccgcgccctgctggtggcctacgacatcccgcaccgc
gactgcggccagttctccggcggcggcgcacccgacggcaccgcctaccgctcctgggtc
gaccgcctcgccgccgggatcggcccccgcccggccaccgtggtgctggagcccgacgcc
gtcgcccacatggtggacggctgcaccccgccccgctaccaggacgaacggtatgcgctg
ctggcctacgcggtcggccggctcacctcgctgccggccaccgcggtctacctggacgcc
ggcaactccggctggatcaccgacccgctgcggatggccggaccgctgcggcgcgccggg
gtcgaccgggcggccgggttcgccctgaacacctccaacttccagaccacccgggccagt
accgcctacgggctgcggctgtccgaggcgctcggcggcaagcacttcgtgatcgacacc
agccgcaacggcaacggcccgctggccggccgcgacccccagcagggctggtgcaacccg
cccggccgggccctgggcaccccgcccaccacccgtaccggccgcaagctcctcgacgcc
tacctgtgggtcaagccccccggcgagtccgacggcccctgcaacggcggacccccggcc
ggccagtggtggcccgagtacgcgctcgacctggcccgcaacgcccgctga

DBGET integrated database retrieval system