KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_2149Help
Entry
SCAT_2149         CDS       T01646                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct00900  Terpenoid backbone biosynthesis
sct01100  Metabolic pathways
sct01110  Biosynthesis of secondary metabolites
sct01130  Biosynthesis of antibiotics
Module
sct_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SCAT_2149 (ispE)
Enzymes [BR:sct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SCAT_2149 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: CCB74860
UniProt: F8JWD2
Position
complement(2284714..2285643)
Genome map
AA seq 309 aa AA seqDB search
MTTAPVTVRVPAKVNAQLAVGPLRADGFHDLANVFLAVGLYDEVTATPADALRITVSGPD
ADQVPLDSGNLAARAAEALAARHGRRADVHLHIAKDIPVAGGMAGGSADAAGALLACDTL
WGTGATRDELLDICAELGSDVPFSLVGGAALGRGRGELLEPLTVGGTFHWVFAVADGGLS
TPAVYRECDRLRQAAAVTVPAPEASPALLAALRTGDAAALAAAVGNDLQAAALSLRPCLA
DTLRTGTEAGALAALVSGSGPTCAFLAEDADAAARIGKALTASGTCRTARATTAPAPGAT
VVAPPTRRH
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccgcccccgtcaccgtccgcgttcccgccaaggtcaacgcgcagctcgccgtg
ggaccgctgcgcgccgacggcttccacgacctggccaacgtcttcctcgcggtcggcctg
tacgacgaggtcaccgccaccccggccgacgccctgcggatcaccgtctccggccccgac
gccgaccaggtgccgctggactccggcaacctcgccgcccgcgccgccgaggccctcgcc
gcccgccacggccgccgggccgacgtccatctgcacatcgccaaggacatcccggtggcc
ggcggcatggccggcggcagcgccgacgccgccggcgccctgctggcctgcgacacgctg
tggggcaccggcgccacccgcgacgaactcctcgacatctgcgccgagttgggcagcgac
gtccccttcagcctggtcggcggcgccgccctgggccgcggacgcggcgaactcctcgaa
cccctcaccgtcggcggcaccttccactgggtcttcgcggtcgccgacggcggcctgtcc
accccggccgtctaccgcgaatgcgaccggctgcgccaggccgccgccgtcaccgtcccc
gcccccgaggcgtcccccgccctgctggcggcgttgcgcaccggcgacgccgccgccctc
gccgccgccgtcggcaacgacctccaggccgccgcgctgtcgctgcgcccctgcctcgcc
gacaccctgcgcaccggcaccgaggccggcgccctcgccgccctcgtctccggctccggc
cccacctgcgccttcctggccgaggacgccgacgccgcggcccggatcggcaaggcgctc
accgcctccggcacctgccgcaccgcccgggccaccaccgcccccgcccccggagccacc
gtcgtcgccccgcccacccggcggcactag

DBGET integrated database retrieval system