KEGG   Streptomyces cattleya NRRL 8057: SCAT_2195Help
Entry
SCAT_2195         CDS       T01646                                 

Gene name
yngB
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SCAT_2195 (yngB)
   00052 Galactose metabolism
    SCAT_2195 (yngB)
   00500 Starch and sucrose metabolism
    SCAT_2195 (yngB)
   00520 Amino sugar and nucleotide sugar metabolism
    SCAT_2195 (yngB)
Enzymes [BR:sct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SCAT_2195 (yngB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2331787..2332698)
Genome map
AA seq 303 aa AA seqDB search
MTLARPRISKAVIPAAGLGTRFLPATKATPKEMLPVVDKPAIQYVVEEAVAAKLTDVLMV
TGRNKRPLEDHFDRNYELEEALTRKGDDSRLARVQESTDLATVHYVRQGAPKGLGHAVLC
AEPHVADQPFAVLLGDDLIDPRDPLLQRMIDAQERYGGSVVALMEVDPAQIHLYGCAAVE
ELPGDGDVVRVTDLVEKPSAADAPSAYAVIGRYVLDPGVFDVLRQTPPGRGGEIQLTDAL
RVLADSEVPGGPVHGVLFSGRRYDTGDRADYLRAIVRLACEREDLGPDFRSWLRRYVTEE
MQP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgacactcgcgcgcccccggatcagcaaggctgtcatccccgccgccggtctcggcacc
cggttcctgccggccaccaaggcgacccccaaggagatgctgccggtcgtggacaagccg
gcgatccagtacgtcgtcgaggaggccgtggcagccaagctgaccgacgtcctgatggtc
accggccgcaacaagcgcccgctggaggaccacttcgaccgcaactacgagctggaggag
gcgctcacccgcaagggcgacgactcccggctcgcccgggtgcaggagtccaccgacctg
gccaccgtgcactacgtccgccagggcgcgcccaagggcctcggccacgccgtgctctgc
gccgagccgcacgtggccgaccagccgttcgccgtcctcctcggcgacgacctgatcgac
ccccgcgatccgctgctccagcgcatgatcgacgcacaggaacgttacggcggcagtgtc
gtcgcgctgatggaggtcgatccggcccagatccacctgtacggctgcgcggccgtcgag
gagctgcccggcgacggggacgtggtgcgggtgaccgatctggtggagaagcccagcgcc
gccgacgccccctccgcctacgcggtgatcggccgctacgtcctcgaccccggcgtcttc
gacgtgctccgccagaccccgcccggacgcggcggcgagatccagctcaccgacgccctg
cgggtgctcgccgactccgaggtgcccggcggtccggtgcacggggtgctcttctcgggg
cggcgctatgacaccggcgaccgcgccgactatcttcgtgcgatcgtacgactcgcctgc
gaacgcgaagacctggggcccgacttcaggtcctggcttcgccgttacgtcacggaggaa
atgcaaccgtga

DBGET integrated database retrieval system