KEGG   Streptomyces cattleya NRRL 8057: SCAT_2449Help
Entry
SCAT_2449         CDS       T01646                                 

Definition
Threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCAT_2449
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCAT_2449
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SCAT_2449
Enzymes [BR:sct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SCAT_2449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2586944..2588224)
Genome map
AA seq 426 aa AA seqDB search
MAVETVAPATRSTDFGNAVALSCRECGERVPLGPVFACAVCFGPLEVAYEFPADPEGLRA
RIEAGPHSIWRYAPLLPVPADVATKPNLDPGFTKLVKADRLARELGVTGGLHIKDDSGNP
THSFKDRVVAIAVEAARNFGLTTLSCSSTGNLAGAVGAAAVRAGFKSCVFIPHDLESGKV
VMAAVYGGDLVGIEGTYDDVNRFCSELIGDPIGEGWGFTNVNLRPYYGEGSKTLAYEICE
QLGWRLPDNIVIPIASGSQLTKIDKGLQELIKLGLVEEKPYRIYGAQAAGCNPVAAAFKA
GHDVVRPVKPDTIAKSLAIGNPADGPYVLDIARRTGGAVEEVDDEQVVDAIKLLARTEGI
FAETAGGVTIGVLKKLIETGQLDPAAETVAINTGDGLKTLDAVAPTTGPTAIIRPTLDSF
REAGLA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgaaaccgtcgcacccgccacccgctcgaccgacttcggcaacgccgtagcc
ttgtcctgccgcgagtgcggcgagcgcgtcccgctcggaccggtcttcgcctgcgcggtc
tgtttcggaccgctggaagtggcgtacgagttccccgccgaccccgaggggctgcgggcg
cgcatcgaggccggaccgcacagcatctggcgctacgccccgctgctgcccgtcccggcc
gacgtggccaccaaacccaacctggaccccggcttcaccaagctggtcaaggccgaccgg
ctcgcccgcgaactcggcgtcaccggcggcctgcacatcaaggacgactccggcaacccc
acccactcgttcaaggaccgggtggtcgccatcgccgtcgaggccgcccgcaacttcggc
ctcaccacgctctcctgctcctccaccggcaacctggccggcgccgtcggggccgccgcg
gtgcgcgcgggcttcaagtcctgcgtcttcatcccgcacgacctggagtccggcaaggtc
gtcatggccgcggtctacggcggcgacctggtcggcatcgagggcacctacgacgacgtc
aaccgcttctgcagcgagctgatcggcgacccgatcggcgagggctggggcttcaccaac
gtcaacctgcgcccctactacggcgagggctccaagacgctggcgtacgagatctgcgag
cagctcggctggcggctgccggacaacatcgtcatccccatcgcctccggctcccagctc
accaagatcgacaaggggctccaggagctgatcaagctgggcctggtcgaggagaagccc
taccggatctacggcgcccaggccgccgggtgcaacccggtggccgccgccttcaaggcc
ggccacgacgtggtgcggccggtcaagccggacaccatcgccaagtcgctggccatcggc
aacccggcggacggcccctacgtgctcgacatcgcccggcgcaccggcggcgcggtcgag
gaggtcgacgacgagcaggtggtcgacgccatcaagctgctcgcccgcaccgagggcatc
ttcgccgagaccgccggcggcgtgaccatcggcgtgctcaagaagctgatcgagaccggt
cagctcgacccggccgccgagaccgtcgccatcaacaccggcgacggactgaagaccctg
gacgcggtggcccccaccaccggtcccaccgcgatcatccgccccacccttgactcgttc
cgagaggctggcctcgcatga

DBGET integrated database retrieval system