KEGG   Streptomyces cattleya NRRL 8057: SCAT_2456Help
Entry
SCAT_2456         CDS       T01646                                 

Definition
ROK-family transcriptional regulator
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:sct01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sct00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sct00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sct00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sct00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:sct00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2594605..2595498
Genome map
AA seq 297 aa AA seqDB search
MKGALVGPDGEPLHEERRPTERGRGPGAVVDSVLEFAAALRERGMRDHGEPAAAAGVAVP
GVVDDAAGVAVYSANIGWRDVPMRALLAERLGGVPVALGHDLRCGGLAEGRLGAGRGQDR
FLFLALGTGIAAAIGIDGRIEAGAHGYAGEIGHIVVRPGGRGCPCGQNGCLETESSASAV
ARDWAEASGDPEATAAGCAHAVAEGDPRALAVWRNAVDTLAAGLVTGLTLLDPRVIVIGG
GLAEAGETLFGPLRTAVAERVTFQKLPLIVPAALGDAAGCLGAGLLAWDRLSMEVTA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcgccctggtcggtccggacggcgagccgttgcacgaggagcggcggccgacg
gagcgggggcgcgggccgggggccgtggtggactcggtgctggagttcgccgccgcgctg
cgggagcgcgggatgcgcgaccacggggagccggccgccgcggccggggtcgcggtgccg
ggggtggtggacgacgccgccggggtcgcggtgtactccgcgaacatcggctggcgtgac
gtgccgatgcgcgcgctcctcgccgagcggctcggcggcgttcccgtcgccctcggccac
gacctgcgctgcggcggcctcgccgagggccggctgggcgccgggcgcggccaggaccgt
ttcctgttcctggcgctcggcaccggtatcgccgccgcgatcggcatcgacggccggatc
gaggccggcgcccacggctacgcgggcgagatcggccacatcgtggtccgtccgggcggg
cgtggctgcccgtgcggccagaacgggtgcctggagacggagtcctccgcgtccgcggtc
gcccgcgactgggccgaggccagtggtgaccccgaggccaccgcggcggggtgcgcgcac
gccgtcgcggagggcgatccgcgcgcgctggcggtgtggcgcaacgccgtggacacgctg
gccgcgggtctggtgaccgggctgaccctgctggacccgcgggtgatcgtgatcggcggc
gggctggccgaggccggggagacgctcttcggcccgttgcggacggcggtcgcggagcgg
gtgacgttccagaagctgcccctgatcgttccggcggccctcggggacgctgccgggtgc
ctgggcgcggggctcctcgcctgggaccgactctccatggaggtaaccgcctga

DBGET integrated database retrieval system