KEGG   Streptomyces cattleya NRRL 8057: SCAT_2497Help
Entry
SCAT_2497         CDS       T01646                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCAT_2497 (gpmA)
   01230 Biosynthesis of amino acids
    SCAT_2497 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAT_2497 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SCAT_2497 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCAT_2497 (gpmA)
Enzymes [BR:sct01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SCAT_2497 (gpmA)
Exosome [BR:sct04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SCAT_2497 (gpmA)
  Exosomal proteins of melanoma cells
   SCAT_2497 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2635030..2635794)
Genome map
AA seq 254 aa AA seqDB search
MAAAAPYRLILLRHGESEWNAKNLFTGWVDVNLNEKGEKEALRGGELLKDAGLLPDVVHT
SLQKRAIRTAQIALEACDRHWIPVHRSWRLNERHYGALQGKDKAQTLAEFGEEQFMLWRR
SYDTPPPPLADGAEFSQSDDPRYATIPSELRPRTECLKDVVGRMLPYWYDGIVPDLLAGR
TVLVAAHGNSLRALVKHLDGISDADIAGLNIPTGIPLSYELDADFHPLTPGGTYLDPEAA
KAAIEAVKNQGKKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgctgctccgtaccgactgatcctgctccgccacggcgagagcgagtggaac
gcgaagaacctgttcaccggctgggtggacgtcaatctgaacgagaagggcgagaaggag
gcgctccgcggcggcgagctgctcaaggacgccggcctcctccccgacgtcgtccacacc
tcgctccagaagcgcgccatccgcaccgcccagatcgccctggaggcgtgcgaccgccac
tggatcccggtgcaccgctcctggcgcctcaacgagcgccactacggcgccctccagggc
aaggacaaggcgcagaccctcgccgagttcggtgaggagcagttcatgctgtggcgccgc
tcctacgacaccccgccgcccccgctggcggacggcgccgagttctcccagagcgacgac
ccgcgctacgccaccatccccagtgagctgcgcccccgcaccgagtgcctcaaggacgtc
gtcggccgcatgctgccgtactggtacgacggcatcgtccccgacctcctggccggccgc
accgtcctcgtcgccgcccacggcaactccctgcgcgccctcgtcaagcacctcgacggc
atttccgacgccgacatcgccggcctcaacatccccaccggcatccccctctcctacgaa
ctcgacgccgacttccaccccctcacccccggcggcacctacctcgaccccgaagccgcc
aaggccgcgatcgaggccgtgaagaaccaggggaagaagaagtag

DBGET integrated database retrieval system