KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_2497Help
Entry
SCAT_2497         CDS       T01646                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct00010  Glycolysis / Gluconeogenesis
sct00260  Glycine, serine and threonine metabolism
sct00680  Methane metabolism
sct01100  Metabolic pathways
sct01110  Biosynthesis of secondary metabolites
sct01120  Microbial metabolism in diverse environments
sct01130  Biosynthesis of antibiotics
sct01200  Carbon metabolism
sct01230  Biosynthesis of amino acids
Module
sct_M00002  Glycolysis, core module involving three-carbon compounds
sct_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAT_2497 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SCAT_2497 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCAT_2497 (gpmA)
Enzymes [BR:sct01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SCAT_2497 (gpmA)
Membrane trafficking [BR:sct04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SCAT_2497 (gpmA)
Exosome [BR:sct04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SCAT_2497 (gpmA)
  Exosomal proteins of melanoma cells
   SCAT_2497 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF4015
Motif
Other DBs
NCBI-ProteinID: CCB75208
UniProt: F8K0R8
Position
complement(2635030..2635794)
Genome map
AA seq 254 aa AA seqDB search
MAAAAPYRLILLRHGESEWNAKNLFTGWVDVNLNEKGEKEALRGGELLKDAGLLPDVVHT
SLQKRAIRTAQIALEACDRHWIPVHRSWRLNERHYGALQGKDKAQTLAEFGEEQFMLWRR
SYDTPPPPLADGAEFSQSDDPRYATIPSELRPRTECLKDVVGRMLPYWYDGIVPDLLAGR
TVLVAAHGNSLRALVKHLDGISDADIAGLNIPTGIPLSYELDADFHPLTPGGTYLDPEAA
KAAIEAVKNQGKKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgctgctccgtaccgactgatcctgctccgccacggcgagagcgagtggaac
gcgaagaacctgttcaccggctgggtggacgtcaatctgaacgagaagggcgagaaggag
gcgctccgcggcggcgagctgctcaaggacgccggcctcctccccgacgtcgtccacacc
tcgctccagaagcgcgccatccgcaccgcccagatcgccctggaggcgtgcgaccgccac
tggatcccggtgcaccgctcctggcgcctcaacgagcgccactacggcgccctccagggc
aaggacaaggcgcagaccctcgccgagttcggtgaggagcagttcatgctgtggcgccgc
tcctacgacaccccgccgcccccgctggcggacggcgccgagttctcccagagcgacgac
ccgcgctacgccaccatccccagtgagctgcgcccccgcaccgagtgcctcaaggacgtc
gtcggccgcatgctgccgtactggtacgacggcatcgtccccgacctcctggccggccgc
accgtcctcgtcgccgcccacggcaactccctgcgcgccctcgtcaagcacctcgacggc
atttccgacgccgacatcgccggcctcaacatccccaccggcatccccctctcctacgaa
ctcgacgccgacttccaccccctcacccccggcggcacctacctcgaccccgaagccgcc
aaggccgcgatcgaggccgtgaagaaccaggggaagaagaagtag

DBGET integrated database retrieval system