KEGG   Streptomyces cattleya NRRL 8057: SCAT_2652Help
Entry
SCAT_2652         CDS       T01646                                 

Gene name
folEA
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sct00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2776266..2776874)
Genome map
AA seq 202 aa AA seqDB search
MTDPVTLNDAGNAAGEFDEKRAENAVRELLLAVGEDPDREGLQETPARVARAYKEIFAGL
WQRPEDVLTTTFDLGHDEMVLVRDIEVYSTCEHHLVPFHGVAHVGYIPATTGKITGLSKL
ARLVDVYARRPQVQERLTTQIADSLMDILEPRGVIVVVECEHMCMSMRGIRKPGAKTTTS
AVRGQLRDPATRAEAMSLILAR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacccggtgacgctgaacgacgcgggtaacgctgccggcgagttcgacgagaag
cgggccgagaacgccgtccgcgaactgctgctcgcggtcggcgaggacccggaccgggaa
ggcctccaggagacccccgcccgggtggcccgcgcctacaaggagatcttcgccgggctg
tggcaacgtccggaggacgtcctgaccaccaccttcgacctcggtcacgacgagatggtg
ctggtgagggacatcgaggtctactcgacctgtgagcaccacctggtgcccttccacggc
gtcgcgcacgtcggctacatcccggccaccaccggcaagatcaccgggctgtccaagctg
gcccggctggtggacgtctacgcccgccgcccccaggtccaggagcggctgaccacccag
atcgccgactcgctgatggacatcctggagccgcgcggcgtgatcgtggtcgtcgagtgc
gagcacatgtgcatgtcgatgcgggggatccgcaagccgggcgccaagaccaccacctcg
gccgtccgcggccagctgcgcgacccggccacccgcgccgaggcgatgagcctgatactg
gcccgctga

DBGET integrated database retrieval system