KEGG   Streptomyces cattleya NRRL 8057: SCAT_2662Help
Entry
SCAT_2662         CDS       T01646                                 

Gene name
asnO
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sct00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2787389..2789239
Genome map
AA seq 616 aa AA seqDB search
MCGITGWISYDNDLTRQRGTLDAMTATMTCRGPDAGGVWLDEHAAFGHRRLAVIDIEGGK
QPMSVERDGRTILVTTYSGEIYNYRELRDELTGLGHHFRTSSDTEVALHAYLEWGEEFTE
HLNGMYAFALWDPRTEECLLVRDRMGIKPLYYHPTPDGVLFGSEPKAILAHPSVRPVVDA
EGLAELVSFTKTPGHAVYKGMREVRPGHLVRIRRQGLTERRYWALEAREHTDDLDTTIRT
VRGLLDDIVARQLIADVPLCTLLSGGLDSSAITALAARGLNAAGRGPVRSFSVDFVGQTE
NFKPDALRSTPDGPYAHALAEHVRSDHRDIVLDPESLIDRGNRAAVLRARDLPIGLGEGD
TSLYLLFKAIRAQSTVALSGESADEVFGGYKWFHDPEAVAADTFPWLVGAGIGNFAGDKT
GTREALFDDGLLAKLDLLDYRQQRYRDALTEVPYRDGDTGLERRMREICYLHLTRFVQVL
LDRKDRASMAVGLEVRVPFCDHRLVQYVFNTPWSMKTFDGREKSLLRAATLDVLPEMVAQ
RVKSPYPSTQDPRYVSALRGELRQLMADKDAPVRPLLDAGAAQQAVEAQDQSFRSSTELV
LAMNAWLRDYGATLEL
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggataaccggctggatctcctacgacaacgacctcacccgccagcggggcacg
ctggacgcgatgaccgcgacgatgacctgccgcggcccggacgccggaggcgtctggctg
gacgagcacgccgccttcggccaccgcaggctcgccgtcatcgacatcgagggcggcaag
cagcccatgagcgtcgaacgggacggccgcaccatcctggtgaccacctacagcggcgag
atctacaactaccgcgaactgcgcgacgaactgaccgggctcggccaccacttccgcacc
agcagcgacaccgaggtcgcgctccacgcctacctggagtggggcgaggagttcaccgaa
cacctcaacggcatgtacgccttcgcgctgtgggacccgcgcaccgaggagtgcctgctg
gtacgcgaccggatgggcatcaagccgctctactaccaccccaccccggacggcgtgctc
ttcggctccgagcccaaggcgatcctcgcccacccctcggtgcgcccggtggtggacgcc
gagggcctggccgagctggtctcgttcaccaagacccccggccacgcggtctacaagggc
atgcgcgaggtacgccccgggcacctggtgagaatccgcaggcaggggctgaccgagcgc
cggtactgggcgctggaggcccgcgagcacaccgacgacctggacaccacgatccgtacc
gtgcgcgggctgctggacgacatcgtggcccggcagctcatcgccgacgtgccgctgtgc
accctgctctccggcggcctggactcctcggcgatcaccgcgctcgccgcccgcgggctg
aacgcggccggacgcggcccggtgcgctccttctcggtcgacttcgtcgggcagaccgag
aacttcaagcccgacgcgctgcgttccaccccggacggcccgtacgcccacgcgctcgcc
gagcacgtgcgctccgaccaccgggacatcgtgctggacccggagtcgctgatcgaccgc
ggcaaccgggccgccgtactgcgcgcccgcgacctgccgatcgggctcggcgagggcgac
acctcgctctacctgctgttcaaggcgatccgtgcgcagtcgacggtggcgctgtcgggc
gagtcggcggacgaggtgttcggcggctacaagtggttccacgacccggaggcggtggcc
gccgacaccttcccgtggctggtgggcgccgggatcggcaacttcgccggggacaagacc
ggcacgagggaggcgctgttcgacgacgggctgctggccaagctcgacctgctggactac
cggcagcagcggtaccgcgacgcgctgaccgaggtgccctaccgggacggcgacaccggg
ctggagcgccggatgcgggagatctgctacctgcacctgacccgtttcgtccaggtgctg
ctggaccgcaaggaccgggccagcatggcggtgggcctggaggtgcgggtgcccttctgc
gaccaccggctggtccagtacgtcttcaacaccccctggtcgatgaagaccttcgacggc
cgggagaagtcgctgctgcgcgcggccaccctcgacgtgctaccggagatggtcgcccag
cgcgtcaagagcccgtaccccagcacccaggacccgcggtacgtcagcgcgctgcgcggg
gagctgcggcagttgatggccgacaaggacgccccggtgcggccgctgctggacgccgga
gcggcccagcaggccgtcgaggcccaggaccagagcttccgcagcagcaccgagctggtg
ctggcgatgaacgcgtggctgcgggactacggggcgacgctggagctgtga

DBGET integrated database retrieval system