KEGG   Streptomyces cattleya NRRL 8057: SCAT_2946Help
Entry
SCAT_2946         CDS       T01646                                 

Gene name
recR
Definition
(RefSeq) DNA repair and recombination protein
  KO
K06187  
recombination protein RecR
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sct00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SCAT_2946 (recR)
DNA repair and recombination proteins [BR:sct03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SCAT_2946 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3095327..3095926)
Genome map
AA seq 199 aa AA seqDB search
MYEGVVQDLIDELGRLPGVGPKSAQRIAFHVLQADPADVRRLAHALAEVKEKVRFCAVCG
NVAQEERCRVCQDPRRDPAVICVVEEPKDVVAIERTREFRGRYHVLGGAISPIEGVGPDD
LRIRELLARLADGTVTELILATDPNLEGEATATYLARMIKPMGLKVTRLASGLPVGGDLE
YADEVTLGRAFEGRRLLDV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgaaggcgtggtccaggacctcatcgacgagctgggcaggctgcccggcgtgggg
cccaagagcgcgcagcggatcgccttccacgtccttcaggccgacccggccgatgtgcgc
cggctggcgcacgcgctcgccgaggtcaaggagaaggtccggttctgcgcggtgtgcggc
aacgtcgcccaggaggaacggtgccgggtctgccaggacccgcgccgcgaccccgcggtg
atatgcgtcgtggaggagcccaaggacgtcgtcgccatcgagcggacccgtgagttccgt
ggccgttaccacgtactgggcggcgccatcagccccatcgagggcgtcggcccggacgac
ctgcggatccgggagctgctggcccggctcgcggacggcacggtgaccgagctgatcctg
gccaccgaccccaacctggagggcgaggccaccgccacctatctggcgcggatgatcaag
cccatgggactgaaggtcacgcggctggccagcgggctccccgtcggcggcgacctggag
tacgccgacgaggtgacgctggggcgtgccttcgaagggagacgactgctcgatgtctga

DBGET integrated database retrieval system