KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_3047Help
Entry
SCAT_3047         CDS       T01646                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct00010  Glycolysis / Gluconeogenesis
sct00020  Citrate cycle (TCA cycle)
sct00620  Pyruvate metabolism
sct01100  Metabolic pathways
sct01110  Biosynthesis of secondary metabolites
sct01120  Microbial metabolism in diverse environments
sct01130  Biosynthesis of antibiotics
sct01200  Carbon metabolism
Module
sct_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAT_3047 (pdhC)
   00020 Citrate cycle (TCA cycle)
    SCAT_3047 (pdhC)
   00620 Pyruvate metabolism
    SCAT_3047 (pdhC)
Enzymes [BR:sct01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SCAT_3047 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: CCB75751
Position
complement(3201614..3203014)
Genome map
AA seq 466 aa AA seqDB search
MTATGQRFREFRMPDVGEGLTEAEILKWYVTVGDTVTDGQTVCEVETAKAAVELPIPFDG
VVSEIRFPEGTTVDVGTPVIVVDTEPGAGAPAESAPEPAEPEPAPEPEPEPAQPKRQAVL
VGYGVAASSTKRRPRKQQPQGAPAPVVPDVVTKAAGPGGQEAVRPLAKPPVRKLAKDLGV
DLAAVVPTGPDGTVTREDVRAAARPEPAGRAQAPEPAEVPQAPAPAPSAVEPGARETRVP
VKGVRKATAQAMVASAFTAPHVTEFVTFDITRTMRLVQELKGDPAFAGLKVSPLLLVAKA
LLVAVKRNPQINAAWDEERQEIVHKHYVNLGIAAATPRGLIVPNIKDAHDKTLPQLAAAL
GDLVTTAREGRTSPADMQGGTLTITNVGVFGVDTGTPILNPGESAILAFGAVKEQPWVHK
GKVKPRQVTTLALSFDHRLVDGELGSKVLADVAAVLEQPKRLMTWA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaaccggtcagcgcttccgtgagttcaggatgcccgacgtgggcgaggggctc
accgaggccgagatcctcaagtggtacgtgacggtgggcgacacggtgaccgacggtcag
accgtgtgcgaggtggagaccgccaaggccgccgtcgaactccccatccccttcgacggg
gtggtctcggagatccgtttccccgagggcaccacggtggacgtgggcaccccggtgatc
gtggtggacaccgagcccggcgcgggcgcccccgccgagtcggcgccggagccggccgag
ccggagcccgcgcccgagccggagccggagcccgcccagcccaagcggcaggcggtgctc
gtcggctacggggtggccgcctcgtccaccaagcgccggccgcgcaagcagcagccgcag
ggcgccccggcccccgtggtccccgacgtggtgaccaaggccgccgggccgggcggccag
gaggcggtccgcccgctggccaagccgccggtgcgcaagctcgccaaggacctcggggtc
gacctggccgccgtggtgccgaccgggccggacggcacggtgacccgcgaggacgtccgg
gcggcggcgcggcccgagccggccgggcgggcgcaggcgcccgagcccgccgaggtgccg
caggcgcccgccccggcgccgtcggccgtcgagccgggggcgcgggagacccgggtgccg
gtcaagggcgtccgcaaggcgaccgcgcaggccatggtggccagcgcgttcaccgcgccg
cacgtcaccgagttcgtcaccttcgacatcacccgcaccatgcggctggtgcaggagctc
aagggcgacccggcgttcgccgggctgaaggtgagcccgctgctgctggtcgccaaggcg
ctgctggtcgccgtcaagcgcaacccgcagatcaacgcggcctgggacgaggaacgccag
gagatcgtccacaagcactacgtcaacctgggcatcgccgcggccaccccgcgtggtctg
atcgtccccaacatcaaggacgcgcacgacaagacgctgccgcaactggcggcggccctc
ggcgacctggtgaccaccgcccgcgagggccgcacctccccggccgacatgcagggcggc
accctcaccatcaccaacgtcggcgtcttcggcgtcgacaccggtacgcccatcctcaac
ccgggggagtccgcgatcctcgccttcggcgcggtcaaggagcagccctgggtgcacaag
ggcaaggtgaagccccgccaggtcaccacgctggcgctctccttcgaccaccggctggtc
gacggcgagctgggttccaaggtgctggcggacgtggccgccgtactggagcagcccaag
cgcctgatgacctgggcgtga

DBGET integrated database retrieval system