KEGG   Streptomyces cattleya NRRL 8057: SCAT_3260Help
Entry
SCAT_3260         CDS       T01646                                 

Gene name
mtnD
Definition
acireductone dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SCAT_3260 (mtnD)
Enzymes [BR:sct01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     SCAT_3260 (mtnD)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     SCAT_3260 (mtnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3430668..3431246)
Genome map
AA seq 192 aa AA seqDB search
MTLLQVMPEDAPGTVLLRTRDEAAIADALAARGVRLRHWPTRGPVTEGTTGDDVLARYRA
EVDALCAAEALRLVDVAQLLPEDTEEWRKRAADARGAFLEEHRHAENEIRFFAHGTGCFY
LHLDDRVYAVVCEAGDLLSVPAGTRHWFDMGPVPEFCAIRFFEEEDGWVGDFTGDPIAGR
FPRLDDLLAAAG
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgctccaggtgatgcccgaggacgcccccggcaccgtgctgctgcgcacccgg
gacgaggccgccatcgccgacgccctcgccgcccgcggggtacggctgcgccactggccg
acccgcggcccggtcaccgagggcaccaccggcgacgacgtgctcgcccggtaccgcgcc
gaggtggacgcgctctgcgccgccgaggcactgcgcctggtcgacgtcgcccagctgctg
ccggaggacaccgaggaatggcgcaagcgggccgccgacgcgcgcggcgccttcctggag
gagcaccgccacgccgagaacgagatccgcttcttcgcacacggcaccggctgcttctac
ctgcacctggacgaccgggtgtacgcggtggtgtgcgaggccggcgacctgctgtcggtg
ccggccggcacccggcactggttcgacatgggcccggtgcccgagttctgcgccatccgc
ttcttcgaggaggaggacggctgggtgggcgacttcaccggcgacccgatcgccggccgc
ttcccccgcctggacgacctgctggcggcggccggatga

DBGET integrated database retrieval system