KEGG   Streptomyces cattleya NRRL 8057: SCAT_3427Help
Entry
SCAT_3427         CDS       T01646                                 

Definition
Uroporphyrin-III C-methyltransferase/uroporphyrinogen-III synthase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SCAT_3427
Enzymes [BR:sct01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     SCAT_3427
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SCAT_3427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3633549..3635168
Genome map
AA seq 539 aa AA seqDB search
MSPTATHKPAAGHVTFLGAGPGDPGLLTLRAVEALADADVLVADPRVLDVVRRHAPAATE
APELTALDGTSGAAAHASKLVMASASNGKRVVRAVAGDPGLDGGAAEEMLACAKAGIPFE
VVPGIANAVGVPAYAGVPIGGDVRFLDGTTADARCWAEAGASDATLVVSTTLEAVAGHAA
ELIAAGRKPDTLLTVTVAGTTTRQRTWTATLATIAAELKATKALPAAEPGQAAIAVVGER
ALADRDHLSWFETKPLFGWRVLVPRTKEQAASLSDQLRSYGAVPHEVPTIAVEPPRTPQQ
MERAVKGLVTGRYEWIAFTSVNAVKAVREKFEEYGLDARAFAGIKVAAVGEQTAKALVDF
GVKPDLVPSGEQSAAGLLEDWPPYDPVFDPIDRVFLPRADIATETLVAGLIELGWEVDDV
TAYRTVRASPPPAETREAIKGGGFDAVLFTSSSTVRNLVGIAGKPHNVTVIACIGPATAK
TAEEHGLRVDVMAPEPSVHALAEALADFGRARRAAAVEAGDPVTRPSERRPGARRRARG
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgagccccaccgccacgcacaagcctgccgcagggcacgtcaccttcctgggtgccggg
cccggtgaccccgggctgttgacactgcgcgccgtggaggcgctggccgacgcggatgtg
ctggtcgccgacccgcgggtgctcgacgtggtgcgcaggcacgcgcccgccgcgacggag
gcaccggaactgaccgcgctggacggcacctcgggcgccgccgcgcacgcctccaagctt
gtcatggcgtccgcgagcaacggcaagcgggtggtccgcgcggtcgccggcgaccccggg
ctggacggcggcgccgccgaggagatgctggcctgcgccaaggccggtatcccgttcgag
gtggtgccgggtatcgccaacgccgtcggggtgcccgcgtacgcgggggtgccgatcggc
ggtgacgtgcggttcctggacggcacgacggcggacgcgcgctgctgggcggaggcgggc
gcctccgacgcgaccctggtggtcagcaccacgctggaggcggtggccggacacgcggcc
gagctgatcgcggccggccgcaagccggacaccttgctgaccgtcacggtggcgggcacc
acgacccggcagcggacctggaccgccacgctggccacgatcgccgccgagctgaaggcc
accaaggcgttgccggccgccgagccggggcaggcggcgatagccgtggtcggggagcgg
gcgctggccgaccgcgaccacctgtcgtggttcgagaccaagccgctgttcggctggcgg
gtgctggtgccgcgcaccaaggagcaggccgcctccctctccgaccagctgcgttcctac
ggcgcggtgccgcacgaggtgccgaccatcgcggtggagccgccgcgtaccccgcagcag
atggagcgggcggtcaagggtctggtgaccgggcggtacgagtggatcgccttcacctcg
gtcaacgccgtcaaggcggtgcgggagaagttcgaggagtacgggctggacgcccgggcg
ttcgccgggatcaaggtggccgcggtcggcgagcagaccgccaaggcgctggtggacttc
ggcgtcaagccggacctggtgccctccggtgagcagtcggcggccgggctgctggaggac
tggccgccgtacgacccggtgttcgacccgatcgaccgggtgttcctgccgcgcgccgac
atcgccaccgagacgctggtggccggcctgatcgagctgggctgggaggtggacgacgtg
accgcgtaccggacggtgcgcgcctcgccgccgccggccgagacccgggaggcgatcaag
ggcggcgggttcgacgccgtgctgttcacctcttcgagtacggtgcgcaacctggtcggc
atcgccggcaagccgcacaacgtcacggtgatcgcctgcatcggcccggccaccgcgaag
acggccgaggagcacgggctgcgggtggacgtgatggcgccggagccgtcggtgcacgcg
ctcgccgaggcgctggcagacttcggccgggcgcgccgggcggcggcggtggaggccggc
gacccggtgacccggcccagtgagcgccgtcccggcgcacggaggagggcccgcggatga

DBGET integrated database retrieval system