KEGG   Streptomyces cattleya NRRL 8057: SCAT_3428Help
Entry
SCAT_3428         CDS       T01646                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (porphobilinogen synthase)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sct00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3635165..3636157
Genome map
AA seq 330 aa AA seqDB search
MSGNEAPVVRPRRLRTTPAMRRMVAETRLHPADLILPAFVREGIDEPVAIGSMPGVYQHT
RDSLRKAAAEAVAAGVGGIMLFGVPLHKDATGSQGTDPDGILQVAIRDVKAEVGDDLVIM
SDLCLDEFTDHGHCGVLDERGRVDNDATLERYAQMARVQADAGVHVVGPSGMMDGQVRVV
RAALDAAGHQDVSILAYTAKYASAFYGPFREAVNSSLRGDRKTYQQDPANARESLRELEL
DLAEGADMVMVKPALPYLDILRQIADAVDVPVAAYQISGEYAMVEAAAANGWIDRDRAIM
ETLTGIRRAGAGMVLTYWATEAALRLRRGE
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggaacgaagcaccggtggtccggccgcggcggctgcggaccaccccggcgatg
cgccggatggtggcggagacgcggctgcacccggccgatctgatcctgcccgccttcgtg
cgggagggcatcgacgagccggtggccatcggttcgatgccgggggtgtaccagcacacc
cgggactcgctgcgcaaggcggcggccgaggcggtggcggccggggtgggcggcatcatg
ctcttcggggtgccgctgcacaaggacgcgaccggctcccagggcaccgacccggacggc
atcctccaggtggcgatcagggacgtgaaggccgaggtcggcgacgacctggtgatcatg
tccgatctgtgtctggacgagttcaccgaccacggtcactgcggggtgctggacgagcgc
ggccgggtggacaacgacgccacgctggagcggtacgcgcagatggcccgggtccaggcg
gacgcgggggtgcacgtggtgggccccagcggcatgatggacggccaggtacgggtggtc
cgcgccgcgctggacgccgccggccaccaggacgtgtcgatcctggcgtacaccgccaag
tacgcgtcggcgttctacggcccgttccgcgaggcggtcaactcctcgctgcgcggggac
cgtaagacgtaccagcaggatccggccaatgcgcgcgagtcgctgcgcgagctggagctg
gacctggccgagggcgccgacatggtgatggtcaagcccgccctgccgtatctggacatt
ctgcggcagatcgccgacgcggtggacgtgccggtggcggcgtaccagatctccggcgag
tacgcgatggtggaggcggcggcggccaacggctggatcgaccgggaccgggcgatcatg
gagacgctgaccgggatccggcgggccggcgcgggcatggtgctgacctactgggcgacc
gaggcggcgctgcggttgcgtcgcggggagtga

DBGET integrated database retrieval system