KEGG   Streptomyces cattleya NRRL 8057: SCAT_3673Help
Entry
SCAT_3673         CDS       T01646                                 

Definition
Oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:sct00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3946272..3948128
Genome map
AA seq 618 aa AA seqDB search
MSEEPHGQGPAAAGEDPSHQARPDDGHDGDDRYDYDVIVVGSGFGGSVAALRLTEKGYRV
GVLEAGRRFARGTLPKNSWRVRDYLWAPALGLYGIQRIHLLGNVLVLAGAGVGGGSLNYA
NTLYVPPEPFFTDRQWGEITDWREELAPYYDQARRMLGVRLNPTMTPSDVHLKAAAERMG
VGETFHLAPVGVFFGDGEDADGTVTARPGEEVPDPYFGGAGPARRACVQCGECMTGCRHG
AKNTLTENYLYLAERAGAVIHPMTTVVGVTEDGSGGHLVATVPTDRRRGTRPSVLRARQV
VLAAGTYGTQTLLHAMRDRGDLPRLSPRLGELTRTNSEALVGAQTDDRRYRAAHGEPRAD
FTRGVAITSSIHPNDTTHIEPVRYGKGSNAMGALSVLQVPYGGRAPRWAQFLAHSAKHPW
LALRSLSNRRWSERTIIGLVMQTADNSLTTYRRRKGPGKGLLTARQGHGAPNPTHIPEGA
EAARVLAEEINGFPGSSIGEIADIPMTAHFLGGCPIGADPDHGVIDPYHRLHGHPGIHVV
DGSAVSANLGVNPSLTITAQAERAMALWPNKGDHDPRPAQGTPYQRVAPVTPRRPAVPKE
AFAALVLPVPKVPARPEG
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaggaaccgcacgggcaggggccggccgccgccggcgaggacccgagccatcag
gcgcgccccgacgacggccacgacggggacgaccgctacgactacgacgtgatcgtcgtc
ggctccgggttcggcgggtcggtcgccgcgctgcggctgaccgagaaggggtaccgggtc
ggggtgctggaggccggccgccggttcgcccgcggaacgctgccgaagaactcctggcgg
gtgcgcgactacctgtgggcgcccgccctcgggctctacggcatccagcggatccacctg
ctgggcaacgtcctggtgctggccggcgccggggtgggcggcggctcgctcaactacgcc
aacaccctctacgtcccgccggaaccgttcttcaccgaccgccagtggggggagatcacc
gactggcgcgaggagttggcgccctactacgaccaggccagacggatgctgggggtgcgg
ctcaacccgacgatgaccccttccgacgtccatctgaaggcggcggccgagcggatgggg
gtgggcgaaacgttccatctggcgccggtcggggtcttcttcggcgacggcgaggacgcc
gacggcacggtgaccgcccgccccggcgaggaggtgcccgacccctacttcggcggcgcg
ggaccggcccggcgcgcctgcgtccagtgcggcgagtgcatgaccggctgccgccacggc
gccaagaacacgctcaccgagaactacctgtacctcgccgagcgggccggcgccgtcatc
cacccgatgaccaccgtcgtcggggtcaccgaggacggctccggcggccatctggtggcc
accgtccccaccgaccggcggcgcggcacccggcccagcgtgctgcgggcccgtcaggtc
gtcctcgcggccggcacctacggcacccagacgctgctgcacgccatgcgcgaccggggc
gacctgccgcgcctgtcgccccggctcggcgagctgacccgcaccaactccgaggcgctg
gtgggcgcccagaccgacgaccgccgctaccgcgcggcgcacggcgagccccgggccgac
ttcacccggggcgtcgccatcacctcctccatccaccccaacgacaccacgcacatcgag
ccggtccgctacggcaagggctccaacgccatgggcgcgctctccgtgctccaggtcccg
tacggcggacgggcgccgcgctgggcgcagttcctcgcccacagcgccaaacacccctgg
ctggcgctgcgttcactgtccaaccggcgctggtcggaacggaccatcatcggcctggtg
atgcagaccgccgacaactcgctgaccacgtaccgccggcgcaagggccccggcaaggga
cttctgacggcacgtcagggacatggggcgcccaaccccacccacatacccgagggcgcc
gaggcggcccgggtgctcgccgaggagatcaacggcttccccggcagcagcatcggcgag
atcgcggacatccccatgaccgcccacttcctcggcggctgccccatcggcgccgacccc
gaccacggcgtcatcgacccctaccaccggctccacggccaccccggcatccacgtggtg
gacggctccgcggtctccgccaacctcggcgtcaacccctccctgaccatcacggcccag
gcggaacgggcgatggcgctgtggcccaacaagggcgaccacgacccccgccccgcccag
ggcaccccctaccagcgcgtcgccccggtgaccccgcgccgccccgcggtgccgaaggag
gcgttcgccgcgctggtcctgccggtccccaaggtgccggcgcggccggaggggtga

DBGET integrated database retrieval system