KEGG   Streptomyces cattleya NRRL 8057: SCAT_3786Help
Entry
SCAT_3786         CDS       T01646                                 

Definition
Thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SCAT_3786
Enzymes [BR:sct01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     SCAT_3786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4063986..4065263
Genome map
AA seq 425 aa AA seqDB search
MDVISVIRTKRDRGRLTDEQIDWVIDAYTRGEVADEQMSALAMAILLNGMDRAEIARWTA
AMIASGERMEFSSLPRPTADKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHTGGT
LDKLESIPGWRALLSNDEMMGVLRDVGAVICAAGDGLAPADKKLYALRDVTGTVEAIPLI
ASSIMSKKIAEGTGSLVLDVKVGSGAFMKTVADARELATTMVGLGTDHGVRTVALLTDMS
TPLGLTAGNALEVRESVEVLAGGGPADVVELTLALAREMLDAAGLPDADPAKALRDGTAM
DHWRRMISAQGGDPDAPLPVARERHVVTAPATGVLTGLDAYAVGVAAWRLGAGRSRKEDP
VQAGAGVELHAKPGDQVTAGRPLLTLHTDTPERFDYALQALDGAVTVAPAGTPFTPRPIV
LERIG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcatctccgtcatccgcaccaagcgcgaccgcggccggctgaccgacgagcag
atcgactgggtgatcgacgcctacacccgcggcgaggtcgccgacgagcagatgtcggcg
ctggccatggccatcctgctcaacggcatggaccgggccgagatcgcgcgctggacggcg
gcgatgatcgcctccggcgagcggatggagttctcctcgctgccccggcccaccgccgac
aagcactccaccggcggcgtcggcgacaagatcacgctgccgctggccccgctggtggcc
gcgtgcggcgccgccgtaccgcagctgtccggccgcggcctcggccacaccggcggcacc
ctggacaagctggagtcgatccccggctggcgggcgctgctgtccaacgacgagatgatg
ggcgtcctgcgtgacgtgggcgccgtcatctgcgcggccggcgacggactggccccggcc
gacaagaagctctacgcgctgcgcgacgtcaccggcaccgtcgaggcgatcccgctgatc
gccagctccatcatgagcaagaagatcgccgagggcaccggctcgctggtgctcgacgtc
aaggtgggcagcggcgccttcatgaagaccgtggccgacgcgcgcgagctggccaccacc
atggtgggcctcggcaccgaccacggggtgcgcaccgtcgcgctgctgaccgacatgtcg
accccgctcggcctgaccgcgggcaacgcgctggaggtccgcgagtcggtcgaggtgctg
gccggcggcggccccgccgacgtcgtcgaactcaccctggcgctcgcccgcgagatgctg
gacgcggccgggctgcccgacgccgacccggccaaggcgctgcgcgacggcaccgcgatg
gaccactggcgccgcatgatcagcgcgcagggcggcgaccccgacgcgccgctgccggtg
gcccgcgaacgccacgtggtcaccgcccccgccaccggcgtcctcaccgggctggacgcc
tacgccgtcggcgtcgccgcctggcggctgggcgccggccgctcccgcaaggaggacccg
gtccaggccggcgccggcgtcgaactccacgccaagcccggcgaccaggtcaccgccggc
cggccgctgctcaccctgcacaccgacacccccgagcgcttcgactacgccctccaggcg
ctcgacggcgccgtcaccgtcgccccggccggcacccccttcaccccgcgcccgatcgtg
ctggagcggatcggctga

DBGET integrated database retrieval system